BLASTX nr result
ID: Cimicifuga21_contig00028249
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00028249 (759 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522600.1| conserved hypothetical protein [Ricinus comm... 56 7e-06 >ref|XP_002522600.1| conserved hypothetical protein [Ricinus communis] gi|223538076|gb|EEF39687.1| conserved hypothetical protein [Ricinus communis] Length = 221 Score = 56.2 bits (134), Expect = 7e-06 Identities = 32/101 (31%), Positives = 46/101 (45%) Frame = -1 Query: 369 NFPGWSNWIWGAFLTLLLPFAKNKWGPLQVLKIQVDSALETAEMVTXXXXXXXXXXXXXX 190 NFP W+ W+ G+ L+L LPF K KW L++++ Q + LE E V Sbjct: 92 NFPTWAKWVLGSILSLFLPFWKQKWEKLKMIEGQAEIVLEEVETVAAVVGKAAMAAEKFS 151 Query: 189 XXXXXKLPNDVKLKEAMKRVESLXXXXXXXXXXXXXVMHKV 67 KLP++ KLK+A VE + +HKV Sbjct: 152 AEEAEKLPDNGKLKKAALLVEGISKATAHDAQLTKDFIHKV 192