BLASTX nr result
ID: Cimicifuga21_contig00028147
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00028147 (373 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containi... 127 1e-27 ref|XP_002321639.1| predicted protein [Populus trichocarpa] gi|2... 124 1e-26 ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containi... 122 3e-26 ref|XP_002877605.1| pentatricopeptide repeat-containing protein ... 121 7e-26 ref|NP_190408.1| pentatricopeptide repeat-containing protein [Ar... 121 7e-26 >ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cucumis sativus] gi|449524136|ref|XP_004169079.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cucumis sativus] Length = 632 Score = 127 bits (318), Expect = 1e-27 Identities = 57/92 (61%), Positives = 72/92 (78%) Frame = -2 Query: 372 TLDKTVYVGHHRSLTSAGKFGEAEKVLDKMRNAGFEPDILIYRHLVFGLCKTGKLEEAIK 193 +L K +Y G HRSLTS GKF +AE ++ MRNAG+EPD + Y LVFGLCK +LEEA K Sbjct: 362 SLSKAMYDGIHRSLTSTGKFDDAENIVKSMRNAGYEPDNVTYSQLVFGLCKARRLEEARK 421 Query: 192 VLDEMEAKGCVPDMKTWRFLIEGHCKAAEIEL 97 VLDEMEA+GC+PD+KTW LI+GHC A E+++ Sbjct: 422 VLDEMEAQGCIPDIKTWTILIQGHCNANELDI 453 >ref|XP_002321639.1| predicted protein [Populus trichocarpa] gi|222868635|gb|EEF05766.1| predicted protein [Populus trichocarpa] Length = 476 Score = 124 bits (310), Expect = 1e-26 Identities = 57/91 (62%), Positives = 72/91 (79%) Frame = -2 Query: 372 TLDKTVYVGHHRSLTSAGKFGEAEKVLDKMRNAGFEPDILIYRHLVFGLCKTGKLEEAIK 193 +L K+VY G HRS TSAGKF EAEK++ MR+AG+EPD + Y LVFGLCK+ +LEEA K Sbjct: 216 SLSKSVYDGMHRSFTSAGKFDEAEKIVKAMRDAGYEPDNITYSQLVFGLCKSKRLEEACK 275 Query: 192 VLDEMEAKGCVPDMKTWRFLIEGHCKAAEIE 100 VLDEMEA GC+PD+KTW LI+GH A +++ Sbjct: 276 VLDEMEAGGCIPDIKTWTILIQGHFAANQVD 306 >ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Vitis vinifera] Length = 631 Score = 122 bits (306), Expect = 3e-26 Identities = 57/91 (62%), Positives = 70/91 (76%) Frame = -2 Query: 372 TLDKTVYVGHHRSLTSAGKFGEAEKVLDKMRNAGFEPDILIYRHLVFGLCKTGKLEEAIK 193 +L K VY G HRSLTS G+F EA K+++ MR+AG EPD + Y LV+GLCK KLEEA K Sbjct: 369 SLCKAVYDGIHRSLTSVGRFDEAGKIMESMRSAGCEPDNITYSQLVYGLCKARKLEEACK 428 Query: 192 VLDEMEAKGCVPDMKTWRFLIEGHCKAAEIE 100 +LDEMEA GCVPD+KTW LI+GHC A E++ Sbjct: 429 LLDEMEACGCVPDIKTWTILIQGHCAAKEVD 459 >ref|XP_002877605.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297323443|gb|EFH53864.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 618 Score = 121 bits (303), Expect = 7e-26 Identities = 56/91 (61%), Positives = 69/91 (75%) Frame = -2 Query: 372 TLDKTVYVGHHRSLTSAGKFGEAEKVLDKMRNAGFEPDILIYRHLVFGLCKTGKLEEAIK 193 +L K VY G HRSLTS G+F EAE++ MRNAG+EPD + Y LVFGLCK +LEEA Sbjct: 364 SLSKAVYDGIHRSLTSVGRFDEAEEITKAMRNAGYEPDNITYSQLVFGLCKAKRLEEARG 423 Query: 192 VLDEMEAKGCVPDMKTWRFLIEGHCKAAEIE 100 VLD+MEA+GC PD+KTW LI+GHCK E++ Sbjct: 424 VLDQMEAQGCFPDIKTWTILIQGHCKNNELD 454 >ref|NP_190408.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75207690|sp|Q9STK5.1|PP269_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g48250, chloroplastic; Flags: Precursor gi|4678363|emb|CAB41173.1| putative protein [Arabidopsis thaliana] gi|332644870|gb|AEE78391.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 621 Score = 121 bits (303), Expect = 7e-26 Identities = 56/91 (61%), Positives = 69/91 (75%) Frame = -2 Query: 372 TLDKTVYVGHHRSLTSAGKFGEAEKVLDKMRNAGFEPDILIYRHLVFGLCKTGKLEEAIK 193 +L K VY G HRSLTS G+F EAE++ MRNAG+EPD + Y LVFGLCK +LEEA Sbjct: 367 SLSKAVYDGIHRSLTSVGRFDEAEEITKAMRNAGYEPDNITYSQLVFGLCKAKRLEEARG 426 Query: 192 VLDEMEAKGCVPDMKTWRFLIEGHCKAAEIE 100 VLD+MEA+GC PD+KTW LI+GHCK E++ Sbjct: 427 VLDQMEAQGCFPDIKTWTILIQGHCKNNELD 457