BLASTX nr result
ID: Cimicifuga21_contig00028123
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00028123 (226 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007475969.1| ribulose 1,5-bisphosphate carboxylase/oxygen... 76 3e-12 ref|XP_004174160.1| PREDICTED: ribulose bisphosphate carboxylase... 76 3e-12 gb|AAZ94659.1| ribulose-1,5-bisphosphate carboxylase/oxygenase l... 76 3e-12 tpg|DAA49738.1| TPA: hypothetical protein ZEAMMB73_563390 [Zea m... 76 3e-12 gb|AFW78859.1| ribulose bisphosphate carboxylase large chain Pre... 76 3e-12 >ref|YP_007475969.1| ribulose 1,5-bisphosphate carboxylase/oxygenase large subunit [Bismarckia nobilis] gi|449326452|gb|AGE93034.1| ribulose 1,5-bisphosphate carboxylase/oxygenase large subunit [Bismarckia nobilis] Length = 487 Score = 75.9 bits (185), Expect = 3e-12 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +3 Query: 120 MSCREGLMSPQTETKASVGFKAGVKDYKLTYYTPE 224 MSCREGLMSPQTETKASVGFKAGVKDYKLTYYTPE Sbjct: 1 MSCREGLMSPQTETKASVGFKAGVKDYKLTYYTPE 35 >ref|XP_004174160.1| PREDICTED: ribulose bisphosphate carboxylase large chain-like [Cucumis sativus] Length = 151 Score = 75.9 bits (185), Expect = 3e-12 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +3 Query: 120 MSCREGLMSPQTETKASVGFKAGVKDYKLTYYTPE 224 MSCREGLMSPQTETKASVGFKAGVKDYKLTYYTPE Sbjct: 1 MSCREGLMSPQTETKASVGFKAGVKDYKLTYYTPE 35 >gb|AAZ94659.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Cucumis sativus] Length = 482 Score = 75.9 bits (185), Expect = 3e-12 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +3 Query: 120 MSCREGLMSPQTETKASVGFKAGVKDYKLTYYTPE 224 MSCREGLMSPQTETKASVGFKAGVKDYKLTYYTPE Sbjct: 1 MSCREGLMSPQTETKASVGFKAGVKDYKLTYYTPE 35 >tpg|DAA49738.1| TPA: hypothetical protein ZEAMMB73_563390 [Zea mays] Length = 190 Score = 75.9 bits (185), Expect = 3e-12 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +3 Query: 120 MSCREGLMSPQTETKASVGFKAGVKDYKLTYYTPE 224 MSCREGLMSPQTETKASVGFKAGVKDYKLTYYTPE Sbjct: 1 MSCREGLMSPQTETKASVGFKAGVKDYKLTYYTPE 35 >gb|AFW78859.1| ribulose bisphosphate carboxylase large chain Precursor [Zea mays] gi|414590289|tpg|DAA40860.1| TPA: ribulose bisphosphate carboxylase large chain Precursor [Zea mays] gi|414870046|tpg|DAA48603.1| TPA: ribulose bisphosphate carboxylase large chain Precursor [Zea mays] Length = 483 Score = 75.9 bits (185), Expect = 3e-12 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +3 Query: 120 MSCREGLMSPQTETKASVGFKAGVKDYKLTYYTPE 224 MSCREGLMSPQTETKASVGFKAGVKDYKLTYYTPE Sbjct: 1 MSCREGLMSPQTETKASVGFKAGVKDYKLTYYTPE 35