BLASTX nr result
ID: Cimicifuga21_contig00028045
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00028045 (280 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520791.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002520791.1| conserved hypothetical protein [Ricinus communis] gi|223539922|gb|EEF41500.1| conserved hypothetical protein [Ricinus communis] Length = 421 Score = 56.2 bits (134), Expect = 3e-06 Identities = 35/89 (39%), Positives = 46/89 (51%), Gaps = 1/89 (1%) Frame = -3 Query: 269 PLIISSYSISLRNTPLSPXXXXXXXXXXXXXXLHTNDLNCFLGKPLHFTPDPAAISTQ-E 93 PL SS S+ +R LSP L+ D C LG+ PD + T+ E Sbjct: 4 PLSSSSSSLLIRKARLSPYLFTLLAFIVFVSILYGEDFMCLLGQ---LDPDSDRLLTRTE 60 Query: 92 KDIHKVPFAIGEIEGECDVFSGKWVRDES 6 K K+PFAIG+ CD+FSG+WV+DES Sbjct: 61 KKWEKLPFAIGKTPEGCDLFSGRWVKDES 89