BLASTX nr result
ID: Cimicifuga21_contig00028033
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00028033 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004152308.1| PREDICTED: pentatricopeptide repeat-containi... 64 8e-12 ref|XP_003632466.1| PREDICTED: pentatricopeptide repeat-containi... 66 2e-11 ref|XP_003610927.1| Pentatricopeptide repeat-containing protein ... 64 4e-11 ref|XP_003542017.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-10 ref|XP_002522334.1| pentatricopeptide repeat-containing protein,... 58 6e-10 >ref|XP_004152308.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170-like [Cucumis sativus] gi|449484855|ref|XP_004156999.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170-like [Cucumis sativus] Length = 724 Score = 63.9 bits (154), Expect(2) = 8e-12 Identities = 30/47 (63%), Positives = 32/47 (68%) Frame = -1 Query: 211 YAKCGCLVSARKVFDEMRERDMCSWNTMISGYAKAWKIEEAYELL*K 71 YAKCG LV A KVFDEM RD+CSWN MISGY K E+A L K Sbjct: 163 YAKCGSLVDAEKVFDEMVHRDLCSWNIMISGYVKGGNFEKARNLFDK 209 Score = 30.8 bits (68), Expect(2) = 8e-12 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -3 Query: 80 FVKMPGRDNFLWSTMISG 27 F KMP RDNF W+ +ISG Sbjct: 207 FDKMPNRDNFSWTAIISG 224 >ref|XP_003632466.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170-like, partial [Vitis vinifera] Length = 621 Score = 66.2 bits (160), Expect(3) = 2e-11 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = -1 Query: 211 YAKCGCLVSARKVFDEMRERDMCSWNTMISGYAKAWKIEEAYEL 80 Y KC LV+A+++FDEM ERD+CSWN MISGYAKA +++EA +L Sbjct: 134 YIKCNSLVNAKRLFDEMAERDLCSWNIMISGYAKAGRLQEARKL 177 Score = 25.0 bits (53), Expect(3) = 2e-11 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 80 FVKMPGRDNFLWSTMISG 27 F +M RDNF W+ M SG Sbjct: 178 FDQMTERDNFSWTAMTSG 195 Score = 21.6 bits (44), Expect(3) = 2e-11 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -2 Query: 249 VPVVFISNRLLDL 211 VP V ISNR+LD+ Sbjct: 121 VPGVVISNRILDM 133 >ref|XP_003610927.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355512262|gb|AES93885.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 802 Score = 63.9 bits (154), Expect(2) = 4e-11 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = -1 Query: 211 YAKCGCLVSARKVFDEMRERDMCSWNTMISGYAKAWKIEEAYEL 80 YAKCG LV A+ +FDE+ ++D+CSWNTMISGYA +IE+A +L Sbjct: 108 YAKCGSLVDAQMLFDEIPQKDLCSWNTMISGYANVGRIEQARKL 151 Score = 28.5 bits (62), Expect(2) = 4e-11 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -3 Query: 80 FVKMPGRDNFLWSTMISG 27 F +MP RDNF W+ +ISG Sbjct: 152 FDEMPHRDNFSWNAVISG 169 >ref|XP_003542017.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170-like [Glycine max] Length = 693 Score = 64.3 bits (155), Expect(2) = 3e-10 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -1 Query: 211 YAKCGCLVSARKVFDEMRERDMCSWNTMISGYAKAWKIEEAYEL 80 YAKCG LV A+ +FDEM RD+CSWNTMI GYAK ++E+A +L Sbjct: 132 YAKCGSLVDAQMLFDEMGHRDLCSWNTMIVGYAKLGRLEQARKL 175 Score = 25.0 bits (53), Expect(2) = 3e-10 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -2 Query: 249 VPVVFISNRLLDL 211 VP VFISNRLLD+ Sbjct: 119 VPGVFISNRLLDM 131 >ref|XP_002522334.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223538412|gb|EEF40018.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 507 Score = 57.8 bits (138), Expect(3) = 6e-10 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = -1 Query: 211 YAKCGCLVSARKVFDEMRERDMCSWNTMISGYAKAWKIEEAYEL 80 YAKC LV A+K+F+EM ERD+CSWN +ISG AK ++EA +L Sbjct: 125 YAKCNDLVDAQKLFEEMGERDLCSWNVLISGCAKMGLLKEARKL 168 Score = 29.3 bits (64), Expect(3) = 6e-10 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -3 Query: 80 FVKMPGRDNFLWSTMISG 27 F MP RDNF W+ MISG Sbjct: 169 FDTMPERDNFSWTAMISG 186 Score = 20.8 bits (42), Expect(3) = 6e-10 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -2 Query: 249 VPVVFISNRLLDL 211 +P + ISNRLLD+ Sbjct: 112 IPGLVISNRLLDM 124