BLASTX nr result
ID: Cimicifuga21_contig00028014
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00028014 (495 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313323.1| predicted protein [Populus trichocarpa] gi|2... 56 2e-10 ref|XP_002512250.1| transcription regulator, putative [Ricinus c... 55 4e-10 emb|CAN65204.1| hypothetical protein VITISV_016716 [Vitis vinifera] 53 5e-10 ref|XP_002299923.1| predicted protein [Populus trichocarpa] gi|2... 56 5e-10 ref|XP_002276425.1| PREDICTED: uncharacterized protein LOC100253... 53 5e-10 >ref|XP_002313323.1| predicted protein [Populus trichocarpa] gi|222849731|gb|EEE87278.1| predicted protein [Populus trichocarpa] Length = 413 Score = 56.2 bits (134), Expect(2) = 2e-10 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -3 Query: 262 EKWRKQHILELEAYSRRMELVQDQIKLALEELK 164 EKWRKQHILELE YS+R+ELVQDQI+ L EL+ Sbjct: 377 EKWRKQHILELEVYSKRLELVQDQIRAQLNELR 409 Score = 33.5 bits (75), Expect(2) = 2e-10 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = -2 Query: 464 GIGGIESNPFPLNFGGKSAMNSMIGEVMDEKWRK 363 G+G + N PL+FG AM +MDEKWRK Sbjct: 354 GVGRLAMNAMPLSFGAGDAM------MMDEKWRK 381 >ref|XP_002512250.1| transcription regulator, putative [Ricinus communis] gi|223548211|gb|EEF49702.1| transcription regulator, putative [Ricinus communis] Length = 415 Score = 54.7 bits (130), Expect(2) = 4e-10 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -3 Query: 262 EKWRKQHILELEAYSRRMELVQDQIKLALEELK 164 EKWRKQ +LELE YS+R+ELVQDQI+ LEEL+ Sbjct: 379 EKWRKQQVLELEVYSKRLELVQDQIRAQLEELR 411 Score = 34.3 bits (77), Expect(2) = 4e-10 Identities = 18/35 (51%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = -2 Query: 464 GIGGIESNPFPLNFGGKSAMNSMIGEVM-DEKWRK 363 GIGG+ N PL+FG +GE+M DEKWRK Sbjct: 357 GIGGLAMNAMPLSFG--------VGEMMVDEKWRK 383 >emb|CAN65204.1| hypothetical protein VITISV_016716 [Vitis vinifera] Length = 424 Score = 52.8 bits (125), Expect(2) = 5e-10 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -3 Query: 262 EKWRKQHILELEAYSRRMELVQDQIKLALEELK 164 E+WRKQ ILELE YS+R+ELVQ+QI+ AL+EL+ Sbjct: 359 ERWRKQQILELEVYSKRLELVQEQIRSALQELR 391 Score = 35.8 bits (81), Expect(2) = 5e-10 Identities = 17/34 (50%), Positives = 20/34 (58%) Frame = -2 Query: 464 GIGGIESNPFPLNFGGKSAMNSMIGEVMDEKWRK 363 G GG+ NP PL+FGG EV DE+WRK Sbjct: 338 GFGGMALNPMPLSFGGT--------EVTDERWRK 363 >ref|XP_002299923.1| predicted protein [Populus trichocarpa] gi|222847181|gb|EEE84728.1| predicted protein [Populus trichocarpa] Length = 413 Score = 55.8 bits (133), Expect(2) = 5e-10 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = -3 Query: 262 EKWRKQHILELEAYSRRMELVQDQIKLALEELK 164 +KWRKQHILELE YS+R+ELVQDQI+ L+EL+ Sbjct: 377 DKWRKQHILELEVYSKRLELVQDQIRAQLDELR 409 Score = 32.7 bits (73), Expect(2) = 5e-10 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -2 Query: 464 GIGGIESNPFPLNFGGKSAMNSMIGEVMDEKWRK 363 G+GG+ N PL+FG M +MD+KWRK Sbjct: 354 GVGGLAMNAMPLSFGVGDVM------MMDDKWRK 381 >ref|XP_002276425.1| PREDICTED: uncharacterized protein LOC100253879 [Vitis vinifera] Length = 395 Score = 52.8 bits (125), Expect(2) = 5e-10 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -3 Query: 262 EKWRKQHILELEAYSRRMELVQDQIKLALEELK 164 E+WRKQ ILELE YS+R+ELVQ+QI+ AL+EL+ Sbjct: 359 ERWRKQQILELEVYSKRLELVQEQIRSALQELR 391 Score = 35.8 bits (81), Expect(2) = 5e-10 Identities = 17/34 (50%), Positives = 20/34 (58%) Frame = -2 Query: 464 GIGGIESNPFPLNFGGKSAMNSMIGEVMDEKWRK 363 G GG+ NP PL+FGG EV DE+WRK Sbjct: 338 GFGGMALNPMPLSFGGT--------EVTDERWRK 363