BLASTX nr result
ID: Cimicifuga21_contig00027427
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00027427 (238 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511313.1| pentatricopeptide repeat-containing protein,... 92 6e-17 ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containi... 88 8e-16 ref|XP_002321639.1| predicted protein [Populus trichocarpa] gi|2... 85 7e-15 ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containi... 82 3e-14 ref|XP_003550712.1| PREDICTED: pentatricopeptide repeat-containi... 79 5e-13 >ref|XP_002511313.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550428|gb|EEF51915.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 627 Score = 91.7 bits (226), Expect = 6e-17 Identities = 43/77 (55%), Positives = 57/77 (74%) Frame = -3 Query: 233 VLVNGLCSKGRVDSAYTMVMGMLDKSNLKPLQPTYKHLIENLLGGRKLKEAMRLLRLMRK 54 VL+N S+ R+D AYT+ M M+DK+ L+P Q TYK LIE LL RKL+EA+ LLRLM++ Sbjct: 480 VLINAFLSQKRIDGAYTLFMDMVDKARLRPWQATYKLLIEKLLEVRKLEEALNLLRLMKQ 539 Query: 53 HQYPQLREPFIDYISKF 3 H +P EPF+ YIS+F Sbjct: 540 HNHPPFPEPFVQYISRF 556 >ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Vitis vinifera] Length = 631 Score = 87.8 bits (216), Expect = 8e-16 Identities = 42/78 (53%), Positives = 57/78 (73%) Frame = -3 Query: 236 EVLVNGLCSKGRVDSAYTMVMGMLDKSNLKPLQPTYKHLIENLLGGRKLKEAMRLLRLMR 57 EVL+NG S+ R+D AY +++ M++ ++L P Q TYK +I LLG RKL+EA+ LL LM+ Sbjct: 481 EVLINGFLSQKRIDGAYKLLVEMVNTAHLVPWQATYKLMINKLLGVRKLEEAINLLHLMK 540 Query: 56 KHQYPQLREPFIDYISKF 3 K YP EPFI+YISKF Sbjct: 541 KQNYPPFPEPFIEYISKF 558 >ref|XP_002321639.1| predicted protein [Populus trichocarpa] gi|222868635|gb|EEF05766.1| predicted protein [Populus trichocarpa] Length = 476 Score = 84.7 bits (208), Expect = 7e-15 Identities = 44/78 (56%), Positives = 54/78 (69%) Frame = -3 Query: 236 EVLVNGLCSKGRVDSAYTMVMGMLDKSNLKPLQPTYKHLIENLLGGRKLKEAMRLLRLMR 57 +VLV G S+ ++D AYT ++ M++K L P Q TYK LIE LL RKL+EA LLRLM+ Sbjct: 328 DVLVKGFLSQRKMDGAYTFLVEMVNKLRLVPWQATYKLLIEKLLQVRKLEEATDLLRLMK 387 Query: 56 KHQYPQLREPFIDYISKF 3 KH YP EPF YISKF Sbjct: 388 KHNYPPFPEPFDQYISKF 405 >ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cucumis sativus] gi|449524136|ref|XP_004169079.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cucumis sativus] Length = 632 Score = 82.4 bits (202), Expect = 3e-14 Identities = 37/78 (47%), Positives = 59/78 (75%) Frame = -3 Query: 236 EVLVNGLCSKGRVDSAYTMVMGMLDKSNLKPLQPTYKHLIENLLGGRKLKEAMRLLRLMR 57 +VL++G ++ +++ AY +++ + +K++++P Q TYK LI+NLL RKL+EA+ LLRLM+ Sbjct: 474 DVLISGFLNQKKLNGAYQLLIELTNKAHVRPWQATYKQLIKNLLEVRKLEEAIALLRLMK 533 Query: 56 KHQYPQLREPFIDYISKF 3 K YP EPF+ YISKF Sbjct: 534 KQNYPPFPEPFVQYISKF 551 >ref|XP_003550712.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Glycine max] Length = 635 Score = 78.6 bits (192), Expect = 5e-13 Identities = 38/78 (48%), Positives = 50/78 (64%) Frame = -3 Query: 236 EVLVNGLCSKGRVDSAYTMVMGMLDKSNLKPLQPTYKHLIENLLGGRKLKEAMRLLRLMR 57 +VL +G S+ R++ AY +V + K + P Q TYK LIE LLG K +EA+ LLRLM+ Sbjct: 480 DVLADGFLSQKRIEGAYELVAEISRKCRISPWQATYKKLIEKLLGVMKFEEALELLRLMK 539 Query: 56 KHQYPQLREPFIDYISKF 3 H YP PF+ YISKF Sbjct: 540 SHNYPPYHLPFVPYISKF 557