BLASTX nr result
ID: Cimicifuga21_contig00027426
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00027426 (291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002321639.1| predicted protein [Populus trichocarpa] gi|2... 70 9e-14 ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containi... 65 4e-13 ref|XP_002511313.1| pentatricopeptide repeat-containing protein,... 63 6e-12 ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containi... 63 2e-08 ref|XP_002459173.1| hypothetical protein SORBIDRAFT_03g047260 [S... 45 4e-08 >ref|XP_002321639.1| predicted protein [Populus trichocarpa] gi|222868635|gb|EEF05766.1| predicted protein [Populus trichocarpa] Length = 476 Score = 70.5 bits (171), Expect(3) = 9e-14 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -2 Query: 116 LKKHNFPPYPEPFDNYISKFGTVEDAREFLKVLSVKQY 3 +KKHN+PP+PEPFD YISKFGTVEDA F KVLSVK+Y Sbjct: 386 MKKHNYPPFPEPFDQYISKFGTVEDAVNFFKVLSVKEY 423 Score = 26.6 bits (57), Expect(3) = 9e-14 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -1 Query: 288 DADLLEVLVNGLCSNRRVE 232 DADLL+VLV G S R+++ Sbjct: 323 DADLLDVLVKGFLSQRKMD 341 Score = 23.9 bits (50), Expect(3) = 9e-14 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 232 DSAYTLLIEMVDKAK 188 D AYT L+EMV+K + Sbjct: 341 DGAYTFLVEMVNKLR 355 >ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Vitis vinifera] Length = 631 Score = 65.5 bits (158), Expect(2) = 4e-13 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = -2 Query: 122 HFLKKHNFPPYPEPFDNYISKFGTVEDAREFLKVLSVKQY 3 H +KK N+PP+PEPF YISKFGTVEDA EFL LS K+Y Sbjct: 537 HLMKKQNYPPFPEPFIEYISKFGTVEDAGEFLNALSAKKY 576 Score = 33.9 bits (76), Expect(2) = 4e-13 Identities = 19/38 (50%), Positives = 23/38 (60%), Gaps = 8/38 (21%) Frame = -1 Query: 291 ADADLLEVLVNGLCSNRR--------VEIVRTPCLLRW 202 ADADLLEVL+NG S +R VE+V T L+ W Sbjct: 475 ADADLLEVLINGFLSQKRIDGAYKLLVEMVNTAHLVPW 512 >ref|XP_002511313.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550428|gb|EEF51915.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 627 Score = 63.2 bits (152), Expect(3) = 6e-12 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -2 Query: 116 LKKHNFPPYPEPFDNYISKFGTVEDAREFLKVLSVKQY 3 +K+HN PP+PEPF YIS+FGTV+DA +FLK LSVK+Y Sbjct: 537 MKQHNHPPFPEPFVQYISRFGTVDDAADFLKALSVKEY 574 Score = 25.8 bits (55), Expect(3) = 6e-12 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -1 Query: 288 DADLLEVLVNGLCSNRRVE 232 DADLL VL+N S +R++ Sbjct: 474 DADLLAVLINAFLSQKRID 492 Score = 25.8 bits (55), Expect(3) = 6e-12 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -3 Query: 232 DSAYTLLIEMVDKAK 188 D AYTL ++MVDKA+ Sbjct: 492 DGAYTLFMDMVDKAR 506 >ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cucumis sativus] gi|449524136|ref|XP_004169079.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cucumis sativus] Length = 632 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -2 Query: 116 LKKHNFPPYPEPFDNYISKFGTVEDAREFLKVLSVKQY 3 +KK N+PP+PEPF YISKFGTV+DA +FLKVLS K+Y Sbjct: 532 MKKQNYPPFPEPFVQYISKFGTVQDADDFLKVLSSKEY 569 >ref|XP_002459173.1| hypothetical protein SORBIDRAFT_03g047260 [Sorghum bicolor] gi|241931148|gb|EES04293.1| hypothetical protein SORBIDRAFT_03g047260 [Sorghum bicolor] Length = 574 Score = 44.7 bits (104), Expect(3) = 4e-08 Identities = 20/36 (55%), Positives = 25/36 (69%) Frame = -2 Query: 116 LKKHNFPPYPEPFDNYISKFGTVEDAREFLKVLSVK 9 +K FP + +PF YI+K GTVEDAR F K L+VK Sbjct: 483 MKTCKFPAFVDPFHPYIAKHGTVEDARNFFKALTVK 518 Score = 32.3 bits (72), Expect(3) = 4e-08 Identities = 13/20 (65%), Positives = 18/20 (90%) Frame = -1 Query: 291 ADADLLEVLVNGLCSNRRVE 232 ADADLL+V++ GLCS+ +VE Sbjct: 419 ADADLLDVILKGLCSHEKVE 438 Score = 24.3 bits (51), Expect(3) = 4e-08 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -3 Query: 232 DSAYTLLIEMVDKAK 188 + AY+L +EMVDKA+ Sbjct: 438 EEAYSLFVEMVDKAE 452