BLASTX nr result
ID: Cimicifuga21_contig00027233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00027233 (293 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277430.1| PREDICTED: pentatricopeptide repeat-containi... 55 6e-06 >ref|XP_002277430.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Length = 500 Score = 55.1 bits (131), Expect = 6e-06 Identities = 36/82 (43%), Positives = 55/82 (67%) Frame = +3 Query: 48 KQLHAHIITTGLHLHQENYIAVKLVTLSTTPSSFSPKNIAYARTLFDASINTANVYLWTS 227 K+LHAH+IT+GLH QEN++ KL+TL T+ SS S + +AR LFDA I+ + YL+ + Sbjct: 5 KRLHAHLITSGLH-QQENHLR-KLITLYTSSSSSS---LHHARLLFDA-IHHPSTYLYNT 58 Query: 228 MITAYSRHQCTSVEAILIYQKM 293 M Y+ T + A+L+++ M Sbjct: 59 MFRVYAASP-TPLHALLLHRHM 79