BLASTX nr result
ID: Cimicifuga21_contig00027161
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00027161 (328 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277289.2| PREDICTED: uncharacterized protein LOC100264... 65 8e-09 ref|XP_003607275.1| Nucleoporin NUP188-like protein [Medicago tr... 65 8e-09 emb|CBI37915.3| unnamed protein product [Vitis vinifera] 65 8e-09 emb|CAN77165.1| hypothetical protein VITISV_029834 [Vitis vinifera] 65 8e-09 ref|XP_002448892.1| hypothetical protein SORBIDRAFT_05g000980 [S... 61 8e-08 >ref|XP_002277289.2| PREDICTED: uncharacterized protein LOC100264071 [Vitis vinifera] Length = 1983 Score = 64.7 bits (156), Expect = 8e-09 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = +3 Query: 171 SGGKELNTLILNDLYYHIQGELEGRMMNSAPFKELAKYMLQLKF 302 S GKELN LIL+DLYYH+QGEL+GR ++ PFKELA+Y+L +F Sbjct: 1237 SEGKELNILILSDLYYHLQGELKGRKIDPGPFKELAQYLLDSQF 1280 >ref|XP_003607275.1| Nucleoporin NUP188-like protein [Medicago truncatula] gi|355508330|gb|AES89472.1| Nucleoporin NUP188-like protein [Medicago truncatula] Length = 1967 Score = 64.7 bits (156), Expect = 8e-09 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +3 Query: 171 SGGKELNTLILNDLYYHIQGELEGRMMNSAPFKELAKYMLQLKF 302 S GKEL LILNDLYYH+QGELEGR M PFKEL++Y+++ F Sbjct: 1237 SEGKELKKLILNDLYYHLQGELEGRKMGIGPFKELSQYLVESSF 1280 >emb|CBI37915.3| unnamed protein product [Vitis vinifera] Length = 1958 Score = 64.7 bits (156), Expect = 8e-09 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = +3 Query: 171 SGGKELNTLILNDLYYHIQGELEGRMMNSAPFKELAKYMLQLKF 302 S GKELN LIL+DLYYH+QGEL+GR ++ PFKELA+Y+L +F Sbjct: 1260 SEGKELNILILSDLYYHLQGELKGRKIDPGPFKELAQYLLDSQF 1303 >emb|CAN77165.1| hypothetical protein VITISV_029834 [Vitis vinifera] Length = 1391 Score = 64.7 bits (156), Expect = 8e-09 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = +3 Query: 171 SGGKELNTLILNDLYYHIQGELEGRMMNSAPFKELAKYMLQLKF 302 S GKELN LIL+DLYYH+QGEL+GR ++ PFKELA+Y+L +F Sbjct: 641 SEGKELNILILSDLYYHLQGELKGRKIDPGPFKELAQYLLDSQF 684 >ref|XP_002448892.1| hypothetical protein SORBIDRAFT_05g000980 [Sorghum bicolor] gi|241934735|gb|EES07880.1| hypothetical protein SORBIDRAFT_05g000980 [Sorghum bicolor] Length = 773 Score = 61.2 bits (147), Expect = 8e-08 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = +3 Query: 171 SGGKELNTLILNDLYYHIQGELEGRMMNSAPFKELAKYMLQLK 299 SG +ELN L++NDLYYHI GELEGR ++S PF+EL ++L+ K Sbjct: 30 SGEQELNNLVINDLYYHICGELEGRQISSGPFQELLSFLLEFK 72