BLASTX nr result
ID: Cimicifuga21_contig00027123
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00027123 (435 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA19288.1| PREDICTED: similar to pol polyprotein putative [... 60 2e-07 emb|CAN81355.1| hypothetical protein VITISV_039158 [Vitis vinifera] 56 3e-06 emb|CAN59952.1| hypothetical protein VITISV_006720 [Vitis vinifera] 56 3e-06 >emb|CCA19288.1| PREDICTED: similar to pol polyprotein putative [Albugo laibachii Nc14] Length = 471 Score = 60.1 bits (144), Expect = 2e-07 Identities = 23/53 (43%), Positives = 38/53 (71%) Frame = +1 Query: 277 ISEWEDAMRDEISASHNNNTWELVLEPKDAESVTSKRAYRLKKKVDETVDRFK 435 + +WE+AMR EI A NNTW+++ +P++A+ + SK Y+LK D T++R+K Sbjct: 31 VKQWEEAMRTEIEALEQNNTWDVIQKPREAKLLHSKGVYKLKMNADGTIERYK 83 >emb|CAN81355.1| hypothetical protein VITISV_039158 [Vitis vinifera] Length = 1402 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/50 (50%), Positives = 32/50 (64%) Frame = +1 Query: 286 WEDAMRDEISASHNNNTWELVLEPKDAESVTSKRAYRLKKKVDETVDRFK 435 W +AM EI+A H N TW+LV PKD + K Y+LK K D +VDR+K Sbjct: 893 WAEAMHTEIAALHKNQTWDLVDPPKDVNIIGCKWVYKLKYKXDGSVDRYK 942 >emb|CAN59952.1| hypothetical protein VITISV_006720 [Vitis vinifera] Length = 1365 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/50 (50%), Positives = 33/50 (66%) Frame = +1 Query: 286 WEDAMRDEISASHNNNTWELVLEPKDAESVTSKRAYRLKKKVDETVDRFK 435 W +AM+ EI+A H N TW+LV PKD + K Y+LK K D +VDR+K Sbjct: 843 WAEAMQTEIAALHKNQTWDLVDPPKDVNIIGCKWVYKLKYKPDGSVDRYK 892