BLASTX nr result
ID: Cimicifuga21_contig00027012
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00027012 (232 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004171040.1| PREDICTED: zinc finger protein ZAT11-like [C... 64 1e-08 ref|XP_004148235.1| PREDICTED: zinc finger protein ZAT11-like [C... 64 1e-08 dbj|BAA21923.1| ZPT2-14 [Petunia x hybrida] 62 4e-08 ref|XP_002299891.1| predicted protein [Populus trichocarpa] gi|2... 61 8e-08 emb|CAQ64474.1| putative Cys2/His2 zinc finger protein [Populus ... 61 8e-08 >ref|XP_004171040.1| PREDICTED: zinc finger protein ZAT11-like [Cucumis sativus] Length = 97 Score = 64.3 bits (155), Expect = 1e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 226 QSKAKAHECSICGLEFPIGQALGGHMRRHRS 134 Q+K KAHECSICG+EFP+GQALGGHMRRHR+ Sbjct: 11 QNKTKAHECSICGVEFPVGQALGGHMRRHRN 41 >ref|XP_004148235.1| PREDICTED: zinc finger protein ZAT11-like [Cucumis sativus] Length = 139 Score = 64.3 bits (155), Expect = 1e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 226 QSKAKAHECSICGLEFPIGQALGGHMRRHRS 134 Q+K KAHECSICG+EFP+GQALGGHMRRHR+ Sbjct: 53 QNKTKAHECSICGVEFPVGQALGGHMRRHRN 83 >dbj|BAA21923.1| ZPT2-14 [Petunia x hybrida] Length = 166 Score = 62.4 bits (150), Expect = 4e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 220 KAKAHECSICGLEFPIGQALGGHMRRHRSMI 128 K K HECSICGLEFPIGQALGGHMRRHR+++ Sbjct: 87 KPKTHECSICGLEFPIGQALGGHMRRHRAVM 117 >ref|XP_002299891.1| predicted protein [Populus trichocarpa] gi|222847149|gb|EEE84696.1| predicted protein [Populus trichocarpa] Length = 197 Score = 61.2 bits (147), Expect = 8e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 223 SKAKAHECSICGLEFPIGQALGGHMRRHRS 134 SK K H+CSICGLEFP+GQALGGHMRRHR+ Sbjct: 97 SKPKTHQCSICGLEFPLGQALGGHMRRHRA 126 >emb|CAQ64474.1| putative Cys2/His2 zinc finger protein [Populus tremula x Populus alba] Length = 196 Score = 61.2 bits (147), Expect = 8e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 223 SKAKAHECSICGLEFPIGQALGGHMRRHRS 134 SK K H+CSICGLEFP+GQALGGHMRRHR+ Sbjct: 94 SKPKTHQCSICGLEFPLGQALGGHMRRHRA 123