BLASTX nr result
ID: Cimicifuga21_contig00027003
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00027003 (205 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526906.1| conserved hypothetical protein [Ricinus comm... 83 3e-14 ref|XP_003539338.1| PREDICTED: uncharacterized protein LOC100814... 80 1e-13 ref|XP_002278840.2| PREDICTED: uncharacterized protein LOC100243... 79 3e-13 emb|CBI15934.3| unnamed protein product [Vitis vinifera] 79 3e-13 ref|XP_003539341.1| PREDICTED: uncharacterized protein LOC100818... 79 4e-13 >ref|XP_002526906.1| conserved hypothetical protein [Ricinus communis] gi|223533745|gb|EEF35478.1| conserved hypothetical protein [Ricinus communis] Length = 853 Score = 82.8 bits (203), Expect = 3e-14 Identities = 35/67 (52%), Positives = 51/67 (76%) Frame = -1 Query: 205 VIFDYEDGCEQRLVFSPDLGEEWKISIEQLRISHDWNEVSGCWSLRGNWLFLELVEEKKK 26 V+FD+EDG E+R +F PDLG+E + I+++RI+ DWN+V+G W RG WLFLEL+EE ++ Sbjct: 87 VVFDHEDGSEKRNIFFPDLGDEMMVHIDKIRITQDWNDVTGTWQNRGTWLFLELIEEYEQ 146 Query: 25 GLSVDLS 5 V +S Sbjct: 147 EHYVPVS 153 >ref|XP_003539338.1| PREDICTED: uncharacterized protein LOC100814680 [Glycine max] Length = 1120 Score = 80.5 bits (197), Expect = 1e-13 Identities = 39/68 (57%), Positives = 52/68 (76%), Gaps = 1/68 (1%) Frame = -1 Query: 205 VIFD-YEDGCEQRLVFSPDLGEEWKISIEQLRISHDWNEVSGCWSLRGNWLFLELVEEKK 29 VIFD + DG E+R VF PDLG+E ++ I QLRI+ DW+EV+G W RGNW+FL+LVEE+K Sbjct: 123 VIFDDHCDGMEKRSVFFPDLGDEMQVGIHQLRITQDWHEVTGEWEQRGNWVFLDLVEEQK 182 Query: 28 KGLSVDLS 5 + V +S Sbjct: 183 RKSFVAVS 190 >ref|XP_002278840.2| PREDICTED: uncharacterized protein LOC100243375 [Vitis vinifera] Length = 1332 Score = 79.3 bits (194), Expect = 3e-13 Identities = 34/67 (50%), Positives = 48/67 (71%) Frame = -1 Query: 205 VIFDYEDGCEQRLVFSPDLGEEWKISIEQLRISHDWNEVSGCWSLRGNWLFLELVEEKKK 26 VIFD+EDG E R VF PDLG+E + ++ +RI+ DWNE + W R NWLFLEL+EE ++ Sbjct: 169 VIFDHEDGLENRKVFFPDLGDELTVGVDNIRITQDWNEGTATWERRRNWLFLELIEEYEQ 228 Query: 25 GLSVDLS 5 +++S Sbjct: 229 DWPLNVS 235 >emb|CBI15934.3| unnamed protein product [Vitis vinifera] Length = 994 Score = 79.3 bits (194), Expect = 3e-13 Identities = 34/67 (50%), Positives = 48/67 (71%) Frame = -1 Query: 205 VIFDYEDGCEQRLVFSPDLGEEWKISIEQLRISHDWNEVSGCWSLRGNWLFLELVEEKKK 26 VIFD+EDG E R VF PDLG+E + ++ +RI+ DWNE + W R NWLFLEL+EE ++ Sbjct: 106 VIFDHEDGLENRKVFFPDLGDELTVGVDNIRITQDWNEGTATWERRRNWLFLELIEEYEQ 165 Query: 25 GLSVDLS 5 +++S Sbjct: 166 DWPLNVS 172 >ref|XP_003539341.1| PREDICTED: uncharacterized protein LOC100818931 [Glycine max] Length = 1218 Score = 79.0 bits (193), Expect = 4e-13 Identities = 38/68 (55%), Positives = 51/68 (75%), Gaps = 1/68 (1%) Frame = -1 Query: 205 VIFD-YEDGCEQRLVFSPDLGEEWKISIEQLRISHDWNEVSGCWSLRGNWLFLELVEEKK 29 VIFD + DG E+R VF PDLG+E ++ I QLRI+ DW+EV+ W RGNW+FL+LVEE+K Sbjct: 249 VIFDDHSDGMEKRSVFFPDLGDEMQVGIHQLRITQDWHEVTEEWEQRGNWVFLDLVEEQK 308 Query: 28 KGLSVDLS 5 + V +S Sbjct: 309 RKSFVAVS 316