BLASTX nr result
ID: Cimicifuga21_contig00025339
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00025339 (488 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527895.1| kinase, putative [Ricinus communis] gi|22353... 61 1e-07 ref|XP_002336113.1| predicted protein [Populus trichocarpa] gi|2... 55 8e-06 >ref|XP_002527895.1| kinase, putative [Ricinus communis] gi|223532670|gb|EEF34452.1| kinase, putative [Ricinus communis] Length = 550 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 3 EHLPAPTNPPFVDEKTMELNDTLEDPGHHLN 95 EHLPAPTNPPF+DEKTMELNDT EDP + LN Sbjct: 502 EHLPAPTNPPFIDEKTMELNDTCEDPWYPLN 532 >ref|XP_002336113.1| predicted protein [Populus trichocarpa] gi|222873004|gb|EEF10135.1| predicted protein [Populus trichocarpa] Length = 651 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = +3 Query: 3 EHLPAPTNPPFVDEKTMELNDTLEDPGHHLN 95 EHLP P+NPPF+DE TMELNDT EDP + LN Sbjct: 603 EHLPRPSNPPFIDEMTMELNDTCEDPCYPLN 633