BLASTX nr result
ID: Cimicifuga21_contig00025197
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00025197 (248 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI31358.3| unnamed protein product [Vitis vinifera] 74 2e-11 ref|XP_002279511.1| PREDICTED: uncharacterized protein At1g22800... 74 2e-11 ref|XP_002327294.1| predicted protein [Populus trichocarpa] gi|2... 70 1e-10 ref|XP_004141554.1| PREDICTED: putative methyltransferase At1g22... 68 9e-10 ref|XP_002528044.1| conserved hypothetical protein [Ricinus comm... 62 5e-08 >emb|CBI31358.3| unnamed protein product [Vitis vinifera] Length = 348 Score = 73.6 bits (179), Expect = 2e-11 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = -1 Query: 146 STESIDGFQSSMPKIFDRHLKCKQRDRAAWLMRPNDPFLDSIAENMLD 3 ST++ DGFQSS KIFDRHLK KQRDRAAWL P DP +D++AEN+LD Sbjct: 35 STDNGDGFQSSRVKIFDRHLKRKQRDRAAWLACPKDPLVDTVAENLLD 82 >ref|XP_002279511.1| PREDICTED: uncharacterized protein At1g22800 [Vitis vinifera] Length = 339 Score = 73.6 bits (179), Expect = 2e-11 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = -1 Query: 146 STESIDGFQSSMPKIFDRHLKCKQRDRAAWLMRPNDPFLDSIAENMLD 3 ST++ DGFQSS KIFDRHLK KQRDRAAWL P DP +D++AEN+LD Sbjct: 26 STDNGDGFQSSRVKIFDRHLKRKQRDRAAWLACPKDPLVDTVAENLLD 73 >ref|XP_002327294.1| predicted protein [Populus trichocarpa] gi|222835664|gb|EEE74099.1| predicted protein [Populus trichocarpa] Length = 121 Score = 70.5 bits (171), Expect = 1e-10 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = -1 Query: 137 SIDGFQSSMPKIFDRHLKCKQRDRAAWLMRPNDPFLDSIAENMLD 3 +IDG QS KIFDR LK KQRDRAAWLMRP+DPF+D++A+N+LD Sbjct: 43 TIDGPQSPRVKIFDRELKRKQRDRAAWLMRPSDPFVDAVADNLLD 87 >ref|XP_004141554.1| PREDICTED: putative methyltransferase At1g22800-like [Cucumis sativus] Length = 177 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = -1 Query: 131 DGFQSSMPKIFDRHLKCKQRDRAAWLMRPNDPFLDSIAENMLD 3 DG QSS K+FDR LK KQRDRAAWLMRP D +DS+AEN+LD Sbjct: 46 DGMQSSKVKVFDRDLKRKQRDRAAWLMRPKDSLVDSVAENLLD 88 >ref|XP_002528044.1| conserved hypothetical protein [Ricinus communis] gi|223532574|gb|EEF34362.1| conserved hypothetical protein [Ricinus communis] Length = 336 Score = 62.0 bits (149), Expect = 5e-08 Identities = 34/67 (50%), Positives = 45/67 (67%) Frame = -1 Query: 203 LSRRVMKTIPLMLQRVAPFSTESIDGFQSSMPKIFDRHLKCKQRDRAAWLMRPNDPFLDS 24 L RR + I Q + + TE+ +S KIFDRHLK QRDRAAWLMRPND F+++ Sbjct: 11 LLRRAYEPIYAFFQSTS-YCTEA-----NSRVKIFDRHLKRVQRDRAAWLMRPNDSFVNA 64 Query: 23 IAENMLD 3 +A+N+LD Sbjct: 65 VADNLLD 71