BLASTX nr result
ID: Cimicifuga21_contig00024317
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00024317 (556 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003522871.1| PREDICTED: uncharacterized protein LOC100814... 57 2e-06 ref|XP_003637456.1| hypothetical protein MTR_086s0012 [Medicago ... 57 2e-06 ref|XP_003637455.1| hypothetical protein MTR_086s0012 [Medicago ... 57 2e-06 ref|XP_003637375.1| hypothetical protein MTR_083s0011, partial [... 57 2e-06 ref|XP_002264033.2| PREDICTED: uncharacterized protein LOC100263... 57 3e-06 >ref|XP_003522871.1| PREDICTED: uncharacterized protein LOC100814328 [Glycine max] Length = 224 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 217 VSRGLTWFTAKFKFQTEGKAFMAIVGVCFGI 309 V RGL+WFT KFKFQT+GKAFMAIVG+C G+ Sbjct: 181 VDRGLSWFTHKFKFQTQGKAFMAIVGLCLGL 211 >ref|XP_003637456.1| hypothetical protein MTR_086s0012 [Medicago truncatula] gi|355503391|gb|AES84594.1| hypothetical protein MTR_086s0012 [Medicago truncatula] Length = 216 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 217 VSRGLTWFTAKFKFQTEGKAFMAIVGVCFGI 309 V RGL+WFT KFKFQ++GKAFMAIVG CFG+ Sbjct: 173 VDRGLSWFTNKFKFQSQGKAFMAIVGFCFGL 203 >ref|XP_003637455.1| hypothetical protein MTR_086s0012 [Medicago truncatula] gi|355503390|gb|AES84593.1| hypothetical protein MTR_086s0012 [Medicago truncatula] Length = 155 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 217 VSRGLTWFTAKFKFQTEGKAFMAIVGVCFGI 309 V RGL+WFT KFKFQ++GKAFMAIVG CFG+ Sbjct: 112 VDRGLSWFTNKFKFQSQGKAFMAIVGFCFGL 142 >ref|XP_003637375.1| hypothetical protein MTR_083s0011, partial [Medicago truncatula] gi|355503310|gb|AES84513.1| hypothetical protein MTR_083s0011, partial [Medicago truncatula] Length = 161 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 217 VSRGLTWFTAKFKFQTEGKAFMAIVGVCFGI 309 V RGL+WFT KFKFQ++GKAFMAIVG CFG+ Sbjct: 118 VDRGLSWFTNKFKFQSQGKAFMAIVGFCFGL 148 >ref|XP_002264033.2| PREDICTED: uncharacterized protein LOC100263253 [Vitis vinifera] Length = 125 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +1 Query: 217 VSRGLTWFTAKFKFQTEGKAFMAIVGVCFGI 309 V RGL+WFT KFKF+++GKAFMAIVG CFG+ Sbjct: 82 VDRGLSWFTVKFKFESQGKAFMAIVGFCFGL 112