BLASTX nr result
ID: Cimicifuga21_contig00024305
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00024305 (1118 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517094.1| pentatricopeptide repeat-containing protein,... 57 8e-06 >ref|XP_002517094.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543729|gb|EEF45257.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 549 Score = 57.0 bits (136), Expect = 8e-06 Identities = 28/49 (57%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = +2 Query: 8 KLAC-FFEEMVLKGFVPWPSTYSRLVEKLKRNNMETEEEKIQQLMVQAE 151 +LAC FFEEMV+KG +P TY LVE+L++NN+ +EKIQ+LM Q E Sbjct: 496 ELACSFFEEMVMKGLIPRDRTYKMLVEELEQNNLTEAKEKIQKLMFQTE 544