BLASTX nr result
ID: Cimicifuga21_contig00024214
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00024214 (471 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI22570.3| unnamed protein product [Vitis vinifera] 59 3e-07 ref|XP_002266751.1| PREDICTED: uncharacterized protein LOC100243... 59 3e-07 emb|CAN64485.1| hypothetical protein VITISV_035038 [Vitis vinifera] 59 3e-07 ref|XP_003628441.1| Leucine-rich repeat receptor-like protein ki... 55 5e-06 ref|XP_004152317.1| PREDICTED: uncharacterized protein LOC101202... 55 8e-06 >emb|CBI22570.3| unnamed protein product [Vitis vinifera] Length = 948 Score = 59.3 bits (142), Expect = 3e-07 Identities = 31/58 (53%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Frame = -3 Query: 463 YHFQILRSKV-QGIKEICKMKMVKQICLLVDVIQYHLEGGCLGDVSRDKYVGRTIKNQ 293 + +IL S V Q I+E K K VKQICLL++ IQ H+EGG GD S D YVG+ IK++ Sbjct: 701 FRMEILCSGVTQSIEESTKQKFVKQICLLLETIQCHMEGGFFGDWSLDNYVGKIIKSR 758 >ref|XP_002266751.1| PREDICTED: uncharacterized protein LOC100243267 [Vitis vinifera] Length = 1018 Score = 59.3 bits (142), Expect = 3e-07 Identities = 31/58 (53%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Frame = -3 Query: 463 YHFQILRSKV-QGIKEICKMKMVKQICLLVDVIQYHLEGGCLGDVSRDKYVGRTIKNQ 293 + +IL S V Q I+E K K VKQICLL++ IQ H+EGG GD S D YVG+ IK++ Sbjct: 771 FRMEILCSGVTQSIEESTKQKFVKQICLLLETIQCHMEGGFFGDWSLDNYVGKIIKSR 828 >emb|CAN64485.1| hypothetical protein VITISV_035038 [Vitis vinifera] Length = 1740 Score = 59.3 bits (142), Expect = 3e-07 Identities = 31/58 (53%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Frame = -3 Query: 463 YHFQILRSKV-QGIKEICKMKMVKQICLLVDVIQYHLEGGCLGDVSRDKYVGRTIKNQ 293 + +IL S V Q I+E K K VKQICLL++ IQ H+EGG GD S D YVG+ IK++ Sbjct: 730 FRMEILCSGVTQSIEESTKQKFVKQICLLLETIQCHMEGGFFGDWSLDNYVGKIIKSR 787 >ref|XP_003628441.1| Leucine-rich repeat receptor-like protein kinase PEPR2 [Medicago truncatula] gi|355522463|gb|AET02917.1| Leucine-rich repeat receptor-like protein kinase PEPR2 [Medicago truncatula] Length = 1061 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/58 (46%), Positives = 42/58 (72%), Gaps = 1/58 (1%) Frame = -3 Query: 463 YHFQILRSKV-QGIKEICKMKMVKQICLLVDVIQYHLEGGCLGDVSRDKYVGRTIKNQ 293 + +IL+S+V +GI++ K K VKQICLL++ IQ H+EGG GD + + YV + IK++ Sbjct: 731 FRLEILQSEVGRGIEDSSKQKFVKQICLLLENIQCHMEGGFFGDWNLENYVAKIIKSR 788 >ref|XP_004152317.1| PREDICTED: uncharacterized protein LOC101202960 [Cucumis sativus] gi|449484881|ref|XP_004157006.1| PREDICTED: uncharacterized LOC101202960 [Cucumis sativus] Length = 1008 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/58 (50%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Frame = -3 Query: 463 YHFQILRSKV-QGIKEICKMKMVKQICLLVDVIQYHLEGGCLGDVSRDKYVGRTIKNQ 293 + +ILRS + I E K K VK ICLL++ IQ HLEGG GD S YVG+ IK++ Sbjct: 771 FRMEILRSLIILNISESMKQKFVKDICLLLETIQCHLEGGFFGDWSIKNYVGKIIKSR 828