BLASTX nr result
ID: Cimicifuga21_contig00024075
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00024075 (212 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524120.1| Ubiquitin carboxyl-terminal hydrolase, putat... 92 6e-17 emb|CBI39086.3| unnamed protein product [Vitis vinifera] 91 1e-16 ref|XP_002267555.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 91 1e-16 gb|AFW56295.1| hypothetical protein ZEAMMB73_640097 [Zea mays] 91 1e-16 ref|XP_002514434.1| Ubiquitin carboxyl-terminal hydrolase, putat... 91 1e-16 >ref|XP_002524120.1| Ubiquitin carboxyl-terminal hydrolase, putative [Ricinus communis] gi|223536688|gb|EEF38330.1| Ubiquitin carboxyl-terminal hydrolase, putative [Ricinus communis] Length = 1120 Score = 91.7 bits (226), Expect = 6e-17 Identities = 46/66 (69%), Positives = 54/66 (81%), Gaps = 3/66 (4%) Frame = -2 Query: 190 RFTWTINNFSRLNTIKHYSDIFLVGGYKCRILIFPKGRDGSVDHLSINLELAD---LPYS 20 +FTWTI NFSRLNT KHYSD+F+VGGYK RILIFPKG +VDHLS+ L+++D LPY Sbjct: 53 KFTWTIENFSRLNTKKHYSDVFVVGGYKWRILIFPKG--NNVDHLSMYLDVSDSSTLPYG 110 Query: 19 SSRYAQ 2 SRYAQ Sbjct: 111 WSRYAQ 116 >emb|CBI39086.3| unnamed protein product [Vitis vinifera] Length = 1116 Score = 90.9 bits (224), Expect = 1e-16 Identities = 46/66 (69%), Positives = 54/66 (81%), Gaps = 3/66 (4%) Frame = -2 Query: 190 RFTWTINNFSRLNTIKHYSDIFLVGGYKCRILIFPKGRDGSVDHLSINLELAD---LPYS 20 RFTWTI NFSRLNT KHYS+IF+VGG+K R+LIFPKG +VDHLS+ L++AD LPY Sbjct: 55 RFTWTIENFSRLNTKKHYSEIFVVGGFKWRVLIFPKG--NNVDHLSMYLDVADSATLPYG 112 Query: 19 SSRYAQ 2 SRYAQ Sbjct: 113 WSRYAQ 118 >ref|XP_002267555.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 12-like [Vitis vinifera] Length = 1117 Score = 90.9 bits (224), Expect = 1e-16 Identities = 46/66 (69%), Positives = 54/66 (81%), Gaps = 3/66 (4%) Frame = -2 Query: 190 RFTWTINNFSRLNTIKHYSDIFLVGGYKCRILIFPKGRDGSVDHLSINLELAD---LPYS 20 RFTWTI NFSRLNT KHYS+IF+VGG+K R+LIFPKG +VDHLS+ L++AD LPY Sbjct: 55 RFTWTIENFSRLNTKKHYSEIFVVGGFKWRVLIFPKG--NNVDHLSMYLDVADSATLPYG 112 Query: 19 SSRYAQ 2 SRYAQ Sbjct: 113 WSRYAQ 118 >gb|AFW56295.1| hypothetical protein ZEAMMB73_640097 [Zea mays] Length = 146 Score = 90.5 bits (223), Expect = 1e-16 Identities = 46/66 (69%), Positives = 53/66 (80%), Gaps = 3/66 (4%) Frame = -2 Query: 190 RFTWTINNFSRLNTIKHYSDIFLVGGYKCRILIFPKGRDGSVDHLSINLELAD---LPYS 20 RFTWTI +FSRLNT KHYSD F+VGGYK R+LIFPKG +VDHLS+ L++AD LPY Sbjct: 60 RFTWTIESFSRLNTKKHYSDAFVVGGYKWRVLIFPKG--NNVDHLSLYLDVADSGSLPYG 117 Query: 19 SSRYAQ 2 SRYAQ Sbjct: 118 WSRYAQ 123 >ref|XP_002514434.1| Ubiquitin carboxyl-terminal hydrolase, putative [Ricinus communis] gi|223546430|gb|EEF47930.1| Ubiquitin carboxyl-terminal hydrolase, putative [Ricinus communis] Length = 1109 Score = 90.5 bits (223), Expect = 1e-16 Identities = 47/66 (71%), Positives = 54/66 (81%), Gaps = 3/66 (4%) Frame = -2 Query: 190 RFTWTINNFSRLNTIKHYSDIFLVGGYKCRILIFPKGRDGSVDHLSINLELAD---LPYS 20 RFTWTI+NFSRLNT K YSD+F+VGGYK RILIFPKG +VDHLS+ L++AD LPY Sbjct: 54 RFTWTIDNFSRLNTKKLYSDVFIVGGYKWRILIFPKG--NNVDHLSMYLDVADSATLPYG 111 Query: 19 SSRYAQ 2 SRYAQ Sbjct: 112 WSRYAQ 117