BLASTX nr result
ID: Cimicifuga21_contig00024071
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00024071 (233 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511288.1| hydrolase, hydrolyzing O-glycosyl compounds,... 49 3e-06 ref|XP_002321648.1| predicted protein [Populus trichocarpa] gi|2... 48 4e-06 >ref|XP_002511288.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] gi|223550403|gb|EEF51890.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] Length = 685 Score = 49.3 bits (116), Expect(2) = 3e-06 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = +1 Query: 1 FLIIDDG*QETVNEFQKDNKPPIEGTQYVLYLLQI 105 FLIIDDG Q+TVNEF+K KPPIEG Q+ L+ I Sbjct: 237 FLIIDDGWQDTVNEFRKGGKPPIEGIQFASRLVDI 271 Score = 26.6 bits (57), Expect(2) = 3e-06 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +2 Query: 179 RFAIRLVDIKDNEKFRDI 232 +FA RLVDIK+N RDI Sbjct: 263 QFASRLVDIKENRNQRDI 280 >ref|XP_002321648.1| predicted protein [Populus trichocarpa] gi|222868644|gb|EEF05775.1| predicted protein [Populus trichocarpa] Length = 752 Score = 47.8 bits (112), Expect(2) = 4e-06 Identities = 22/35 (62%), Positives = 28/35 (80%) Frame = +1 Query: 1 FLIIDDG*QETVNEFQKDNKPPIEGTQYVLYLLQI 105 FLIIDDG Q+TVNEF+K+ +P IEGTQ+ L+ I Sbjct: 236 FLIIDDGWQDTVNEFRKEGEPLIEGTQFATRLVDI 270 Score = 27.7 bits (60), Expect(2) = 4e-06 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +2 Query: 179 RFAIRLVDIKDNEKFR 226 +FA RLVDIK+N KFR Sbjct: 262 QFATRLVDIKENGKFR 277