BLASTX nr result
ID: Cimicifuga21_contig00024013
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00024013 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AER13159.1| putative Ty-1 copia retrotransposon [Phaseolus vu... 58 7e-07 ref|XP_002307225.1| predicted protein [Populus trichocarpa] gi|2... 58 7e-07 ref|XP_002332290.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 >gb|AER13159.1| putative Ty-1 copia retrotransposon [Phaseolus vulgaris] Length = 867 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/75 (37%), Positives = 38/75 (50%) Frame = +2 Query: 2 ALINDDFRRLDRKVQKGGDSSDVLFVRGRKKDKNSGPSKGANNHSRSKSKGKKKDLDPDE 181 AL + + R+ D+ K S + L RGR++ + R SK K + + DE Sbjct: 119 ALYSHELRKQDKMKTKSTTSEEALVARGRQQSQTK--------ERRGMSKSKGRAVAKDE 170 Query: 182 CGFCHEMGHWVKDCP 226 C FCHE GHW KDCP Sbjct: 171 CAFCHEKGHWKKDCP 185 >ref|XP_002307225.1| predicted protein [Populus trichocarpa] gi|222856674|gb|EEE94221.1| predicted protein [Populus trichocarpa] Length = 279 Score = 58.2 bits (139), Expect = 7e-07 Identities = 32/78 (41%), Positives = 45/78 (57%), Gaps = 3/78 (3%) Frame = +2 Query: 2 ALINDDFRRLDRKVQKGGDSSDVLFVRGRKKDKNSGPSKGANNHSRSKSKGKKKD---LD 172 AL+N+++R+ D+ V K +S+ L VRGR K SRSKS+G+ + L Sbjct: 196 ALVNNEYRKKDQIVHKES-TSEALTVRGRTNPKRFR----GRGRSRSKSRGESSNRRYLA 250 Query: 173 PDECGFCHEMGHWVKDCP 226 +EC FCH+ HW KDCP Sbjct: 251 KNECAFCHKKRHWKKDCP 268 >ref|XP_002332290.1| predicted protein [Populus trichocarpa] gi|222832452|gb|EEE70929.1| predicted protein [Populus trichocarpa] Length = 292 Score = 55.8 bits (133), Expect = 3e-06 Identities = 31/78 (39%), Positives = 44/78 (56%), Gaps = 3/78 (3%) Frame = +2 Query: 2 ALINDDFRRLDRKVQKGGDSSDVLFVRGRKKDKNSGPSKGANNHSRSKSKGKKKD---LD 172 AL+N+++R+ D+ V K + + L VRGR + SRSKS+G+ + L Sbjct: 137 ALVNNEYRKKDQIVHKES-TLEALTVRGRTNPRRFR----GQGRSRSKSRGESSNRRYLA 191 Query: 173 PDECGFCHEMGHWVKDCP 226 DEC FCH+ GHW KD P Sbjct: 192 KDECAFCHKKGHWKKDSP 209