BLASTX nr result
ID: Cimicifuga21_contig00023986
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00023986 (338 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280453.2| PREDICTED: putative ABC transporter B family... 70 1e-10 emb|CBI28004.3| unnamed protein product [Vitis vinifera] 70 1e-10 ref|XP_002514211.1| multidrug resistance protein 1, 2, putative ... 69 5e-10 ref|XP_003548594.1| PREDICTED: putative ABC transporter B family... 67 2e-09 ref|XP_002325023.1| multidrug/pheromone exporter, MDR family, AB... 65 4e-09 >ref|XP_002280453.2| PREDICTED: putative ABC transporter B family member 8-like [Vitis vinifera] Length = 1238 Score = 70.5 bits (171), Expect = 1e-10 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = +2 Query: 2 TIKKLDSIAFVAEGKVLERGTYAQLKSKKGAFFNLATL 115 TIKKLDSIAFV+EGKV+ERGTYAQLKSK+GAFFNLA+L Sbjct: 1199 TIKKLDSIAFVSEGKVVERGTYAQLKSKRGAFFNLASL 1236 >emb|CBI28004.3| unnamed protein product [Vitis vinifera] Length = 1009 Score = 70.5 bits (171), Expect = 1e-10 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = +2 Query: 2 TIKKLDSIAFVAEGKVLERGTYAQLKSKKGAFFNLATL 115 TIKKLDSIAFV+EGKV+ERGTYAQLKSK+GAFFNLA+L Sbjct: 970 TIKKLDSIAFVSEGKVVERGTYAQLKSKRGAFFNLASL 1007 >ref|XP_002514211.1| multidrug resistance protein 1, 2, putative [Ricinus communis] gi|223546667|gb|EEF48165.1| multidrug resistance protein 1, 2, putative [Ricinus communis] Length = 1230 Score = 68.6 bits (166), Expect = 5e-10 Identities = 32/40 (80%), Positives = 39/40 (97%) Frame = +2 Query: 2 TIKKLDSIAFVAEGKVLERGTYAQLKSKKGAFFNLATLSS 121 TIKKLDSIAFVA+GKV+E+GTY+QLK+K+GAFFNLATL + Sbjct: 1191 TIKKLDSIAFVADGKVVEQGTYSQLKNKRGAFFNLATLQT 1230 >ref|XP_003548594.1| PREDICTED: putative ABC transporter B family member 8-like [Glycine max] Length = 1290 Score = 66.6 bits (161), Expect = 2e-09 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = +2 Query: 2 TIKKLDSIAFVAEGKVLERGTYAQLKSKKGAFFNLATLSSTDTN 133 TIK+LDSIA+V+EGKVLE+GTYAQL+ K+GAFFNLA+L T N Sbjct: 1195 TIKELDSIAYVSEGKVLEQGTYAQLRHKRGAFFNLASLKQTIYN 1238 >ref|XP_002325023.1| multidrug/pheromone exporter, MDR family, ABC transporter family [Populus trichocarpa] gi|222866457|gb|EEF03588.1| multidrug/pheromone exporter, MDR family, ABC transporter family [Populus trichocarpa] Length = 1205 Score = 65.5 bits (158), Expect = 4e-09 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = +2 Query: 2 TIKKLDSIAFVAEGKVLERGTYAQLKSKKGAFFNLATL 115 TIK LDSIAFVA+GKV+ERGTYAQLK+K+GAFF+LA+L Sbjct: 1167 TIKNLDSIAFVADGKVVERGTYAQLKNKRGAFFDLASL 1204