BLASTX nr result
ID: Cimicifuga21_contig00023941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00023941 (447 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520839.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 ref|XP_003538502.1| PREDICTED: uncharacterized protein LOC100818... 55 6e-06 >ref|XP_002520839.1| conserved hypothetical protein [Ricinus communis] gi|223539970|gb|EEF41548.1| conserved hypothetical protein [Ricinus communis] Length = 561 Score = 57.0 bits (136), Expect = 2e-06 Identities = 37/81 (45%), Positives = 44/81 (54%) Frame = +2 Query: 203 SKKAPSLTSMTELRESDTKPTETLDLFAMQTSKSDETLVSAEKMNNRVEIDTSHPFESVK 382 ++ P + ELR SDT P L Q + T K+ R EIDTS PF SVK Sbjct: 7 AEPVPGTPGIRELR-SDTGP----GLCNQQNGANQGT----RKVGLRAEIDTSPPFGSVK 57 Query: 383 EAVSRFGGSGVWKPYNKSLED 445 EAV+RFGGSG W PY K E+ Sbjct: 58 EAVTRFGGSGSWMPYYKIFEE 78 >ref|XP_003538502.1| PREDICTED: uncharacterized protein LOC100818214 [Glycine max] Length = 559 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +2 Query: 329 KMNNRVEIDTSHPFESVKEAVSRFGGSGVWKPYNKSLED 445 ++N R EIDTS PF SVKEAV+RFGGSG W P+ ++ED Sbjct: 38 RVNFRAEIDTSPPFGSVKEAVTRFGGSGPWIPFFNNIED 76