BLASTX nr result
ID: Cimicifuga21_contig00023847
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00023847 (513 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509570.1| conserved hypothetical protein [Ricinus comm... 133 1e-29 ref|XP_002265795.1| PREDICTED: 54S ribosomal protein L37, mitoch... 130 1e-28 ref|NP_566150.1| Mitochondrial ribosomal protein L37 [Arabidopsi... 128 4e-28 ref|XP_002884262.1| hypothetical protein ARALYDRAFT_896070 [Arab... 127 1e-27 ref|XP_003620189.1| hypothetical protein MTR_6g078300 [Medicago ... 127 1e-27 >ref|XP_002509570.1| conserved hypothetical protein [Ricinus communis] gi|223549469|gb|EEF50957.1| conserved hypothetical protein [Ricinus communis] Length = 130 Score = 133 bits (335), Expect = 1e-29 Identities = 60/72 (83%), Positives = 67/72 (93%) Frame = -1 Query: 513 IGANTLKDGTDPKLLPDSEYPDWLWHLMDKRAPLSELKRRNIEGLPYEELKRFVKLDNRA 334 +GAN LKDG DPK+LPDS+YPDWLWHL+DKR PLSEL+R+NIE LPYE+LKRFVKLDNRA Sbjct: 59 VGANILKDGADPKILPDSDYPDWLWHLLDKRLPLSELRRKNIETLPYEDLKRFVKLDNRA 118 Query: 333 RIKENNSVKAKN 298 IKENNSVKAKN Sbjct: 119 SIKENNSVKAKN 130 >ref|XP_002265795.1| PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Vitis vinifera] Length = 132 Score = 130 bits (327), Expect = 1e-28 Identities = 58/72 (80%), Positives = 67/72 (93%) Frame = -1 Query: 513 IGANTLKDGTDPKLLPDSEYPDWLWHLMDKRAPLSELKRRNIEGLPYEELKRFVKLDNRA 334 +GAN LKDGTDPK+LPDSEYPDWLWHL+DKR LSEL+R+++E LPYE LKRFVKLDNRA Sbjct: 61 VGANILKDGTDPKVLPDSEYPDWLWHLLDKRPALSELRRKSVESLPYEALKRFVKLDNRA 120 Query: 333 RIKENNSVKAKN 298 RIKENN++KAKN Sbjct: 121 RIKENNNLKAKN 132 >ref|NP_566150.1| Mitochondrial ribosomal protein L37 [Arabidopsis thaliana] gi|6016731|gb|AAF01557.1|AC009325_27 unknown protein [Arabidopsis thaliana] gi|6091718|gb|AAF03430.1|AC010797_6 unknown protein [Arabidopsis thaliana] gi|21592342|gb|AAM64293.1| unknown [Arabidopsis thaliana] gi|28393066|gb|AAO41967.1| unknown protein [Arabidopsis thaliana] gi|28827392|gb|AAO50540.1| unknown protein [Arabidopsis thaliana] gi|332640188|gb|AEE73709.1| Mitochondrial ribosomal protein L37 [Arabidopsis thaliana] Length = 126 Score = 128 bits (322), Expect = 4e-28 Identities = 55/72 (76%), Positives = 67/72 (93%) Frame = -1 Query: 513 IGANTLKDGTDPKLLPDSEYPDWLWHLMDKRAPLSELKRRNIEGLPYEELKRFVKLDNRA 334 +GANTLKDG+DPK+LPDS+YPDWLWHL+DKR LSEL+R+N+E LPY++LKRFVKLD R Sbjct: 55 VGANTLKDGSDPKILPDSDYPDWLWHLLDKRPALSELRRKNVETLPYDDLKRFVKLDTRG 114 Query: 333 RIKENNSVKAKN 298 +IKENNS+KAKN Sbjct: 115 KIKENNSIKAKN 126 >ref|XP_002884262.1| hypothetical protein ARALYDRAFT_896070 [Arabidopsis lyrata subsp. lyrata] gi|297330102|gb|EFH60521.1| hypothetical protein ARALYDRAFT_896070 [Arabidopsis lyrata subsp. lyrata] Length = 125 Score = 127 bits (318), Expect = 1e-27 Identities = 55/72 (76%), Positives = 67/72 (93%) Frame = -1 Query: 513 IGANTLKDGTDPKLLPDSEYPDWLWHLMDKRAPLSELKRRNIEGLPYEELKRFVKLDNRA 334 +GANTLKDG+DPK+LPDS+YPDWLW L+DKR LSEL+R+N+E LPY++LKRFVKLD RA Sbjct: 54 VGANTLKDGSDPKILPDSDYPDWLWRLLDKRPALSELRRKNVETLPYDDLKRFVKLDTRA 113 Query: 333 RIKENNSVKAKN 298 +IKENNS+KAKN Sbjct: 114 KIKENNSIKAKN 125 >ref|XP_003620189.1| hypothetical protein MTR_6g078300 [Medicago truncatula] gi|217069986|gb|ACJ83353.1| unknown [Medicago truncatula] gi|355495204|gb|AES76407.1| hypothetical protein MTR_6g078300 [Medicago truncatula] gi|388518995|gb|AFK47559.1| unknown [Medicago truncatula] Length = 131 Score = 127 bits (318), Expect = 1e-27 Identities = 56/72 (77%), Positives = 66/72 (91%) Frame = -1 Query: 513 IGANTLKDGTDPKLLPDSEYPDWLWHLMDKRAPLSELKRRNIEGLPYEELKRFVKLDNRA 334 +G N LK+GTDPK+LPDSEYPDWLWHL+DKR LSEL+R+ I+ LPYE+LKR+VKLDNRA Sbjct: 60 VGGNILKEGTDPKILPDSEYPDWLWHLLDKRPALSELRRKEIDTLPYEDLKRYVKLDNRA 119 Query: 333 RIKENNSVKAKN 298 RIKENNS+KAKN Sbjct: 120 RIKENNSLKAKN 131