BLASTX nr result
ID: Cimicifuga21_contig00023788
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00023788 (263 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531340.1| Frataxin, mitochondrial precursor, putative ... 89 4e-16 ref|XP_002277091.1| PREDICTED: frataxin, mitochondrial isoform 1... 88 8e-16 emb|CAN67530.1| hypothetical protein VITISV_004311 [Vitis vinifera] 88 8e-16 ref|XP_004139965.1| PREDICTED: frataxin, mitochondrial-like [Cuc... 87 1e-15 ref|XP_002319394.1| predicted protein [Populus trichocarpa] gi|2... 87 1e-15 >ref|XP_002531340.1| Frataxin, mitochondrial precursor, putative [Ricinus communis] gi|223529062|gb|EEF31047.1| Frataxin, mitochondrial precursor, putative [Ricinus communis] Length = 200 Score = 89.0 bits (219), Expect = 4e-16 Identities = 37/48 (77%), Positives = 45/48 (93%) Frame = -3 Query: 261 WLSSPVSGPSRFDWDRESQAWVYRRTKANLLQLLESEIKQLCGEPISL 118 WLSSPVSGPSR+DWDR ++AWVYRRTKANL ++LESE++Q+CGEPI L Sbjct: 152 WLSSPVSGPSRYDWDRNAEAWVYRRTKANLFEVLESELEQVCGEPIKL 199 >ref|XP_002277091.1| PREDICTED: frataxin, mitochondrial isoform 1 [Vitis vinifera] gi|296081250|emb|CBI17994.3| unnamed protein product [Vitis vinifera] Length = 197 Score = 87.8 bits (216), Expect = 8e-16 Identities = 38/49 (77%), Positives = 46/49 (93%) Frame = -3 Query: 261 WLSSPVSGPSRFDWDRESQAWVYRRTKANLLQLLESEIKQLCGEPISLT 115 WLSSPVSGPSRFDWD+ +QAWVYRRTKANL +LLE+E+++LCG PISL+ Sbjct: 149 WLSSPVSGPSRFDWDQSAQAWVYRRTKANLSKLLETELEKLCGTPISLS 197 >emb|CAN67530.1| hypothetical protein VITISV_004311 [Vitis vinifera] Length = 202 Score = 87.8 bits (216), Expect = 8e-16 Identities = 38/49 (77%), Positives = 46/49 (93%) Frame = -3 Query: 261 WLSSPVSGPSRFDWDRESQAWVYRRTKANLLQLLESEIKQLCGEPISLT 115 WLSSPVSGPSRFDWD+ +QAWVYRRTKANL +LLE+E+++LCG PISL+ Sbjct: 154 WLSSPVSGPSRFDWDQSAQAWVYRRTKANLSKLLETELEKLCGTPISLS 202 >ref|XP_004139965.1| PREDICTED: frataxin, mitochondrial-like [Cucumis sativus] Length = 191 Score = 87.4 bits (215), Expect = 1e-15 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -3 Query: 261 WLSSPVSGPSRFDWDRESQAWVYRRTKANLLQLLESEIKQLCGEPISLT 115 WLSSP+SGPSRFDWD+ SQ W+YRR KANLL LLE+E+ QLCGEPI L+ Sbjct: 143 WLSSPLSGPSRFDWDQNSQTWIYRRNKANLLSLLETELTQLCGEPIDLS 191 >ref|XP_002319394.1| predicted protein [Populus trichocarpa] gi|222857770|gb|EEE95317.1| predicted protein [Populus trichocarpa] Length = 192 Score = 87.0 bits (214), Expect = 1e-15 Identities = 40/48 (83%), Positives = 42/48 (87%) Frame = -3 Query: 261 WLSSPVSGPSRFDWDRESQAWVYRRTKANLLQLLESEIKQLCGEPISL 118 WLSSPVSGPSRFDWDR QAWVYRRTKANLL +LESE+ QL GEPI L Sbjct: 144 WLSSPVSGPSRFDWDRSDQAWVYRRTKANLLNVLESEMGQLFGEPIKL 191