BLASTX nr result
ID: Cimicifuga21_contig00023765
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00023765 (523 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003549229.1| PREDICTED: glucan endo-1,3-beta-glucosidase ... 55 6e-06 >ref|XP_003549229.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Glycine max] Length = 491 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 429 ALVASNLNFQVKVSSPYSMDVISRSFPPSTA 521 ALVASNLNF+VKVS+P SMDVISR FPPSTA Sbjct: 141 ALVASNLNFRVKVSTPQSMDVISRPFPPSTA 171