BLASTX nr result
ID: Cimicifuga21_contig00023703
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00023703 (1265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002454847.1| hypothetical protein SORBIDRAFT_04g038420 [S... 50 1e-09 gb|AAF79718.1|AC020889_26 T1N15.2 [Arabidopsis thaliana] 49 3e-09 dbj|BAJ34113.1| unnamed protein product [Thellungiella halophila] 49 3e-09 ref|XP_002894111.1| hypothetical protein ARALYDRAFT_473977 [Arab... 49 3e-09 ref|NP_849784.1| protein argonaute [Arabidopsis thaliana] gi|334... 49 3e-09 >ref|XP_002454847.1| hypothetical protein SORBIDRAFT_04g038420 [Sorghum bicolor] gi|241934678|gb|EES07823.1| hypothetical protein SORBIDRAFT_04g038420 [Sorghum bicolor] Length = 1028 Score = 50.1 bits (118), Expect(2) = 1e-09 Identities = 23/38 (60%), Positives = 27/38 (71%), Gaps = 6/38 (15%) Frame = +2 Query: 824 VEASQDWPDITKYAGLVCVQDHR------LFKVWHELQ 919 V ASQDWP++TKYAGLVC Q HR L+KVW + Q Sbjct: 758 VVASQDWPEVTKYAGLVCAQAHRQELIEDLYKVWQDPQ 795 Score = 39.7 bits (91), Expect(2) = 1e-09 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +3 Query: 699 DVTHPHPGEDSCPSIATVI 755 DVTHPHPGEDS PSIA V+ Sbjct: 741 DVTHPHPGEDSSPSIAAVV 759 >gb|AAF79718.1|AC020889_26 T1N15.2 [Arabidopsis thaliana] Length = 1123 Score = 48.9 bits (115), Expect(2) = 3e-09 Identities = 24/38 (63%), Positives = 26/38 (68%), Gaps = 6/38 (15%) Frame = +2 Query: 824 VEASQDWPDITKYAGLVCVQDHR------LFKVWHELQ 919 V ASQDWP+ITKYAGLVC Q HR LFK W + Q Sbjct: 837 VVASQDWPEITKYAGLVCAQAHRQELIQDLFKEWKDPQ 874 Score = 39.7 bits (91), Expect(2) = 3e-09 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +3 Query: 699 DVTHPHPGEDSCPSIATVI 755 DVTHPHPGEDS PSIA V+ Sbjct: 820 DVTHPHPGEDSSPSIAAVV 838 >dbj|BAJ34113.1| unnamed protein product [Thellungiella halophila] Length = 1084 Score = 48.9 bits (115), Expect(2) = 3e-09 Identities = 24/38 (63%), Positives = 26/38 (68%), Gaps = 6/38 (15%) Frame = +2 Query: 824 VEASQDWPDITKYAGLVCVQDHR------LFKVWHELQ 919 V ASQDWP+ITKYAGLVC Q HR LFK W + Q Sbjct: 813 VVASQDWPEITKYAGLVCAQAHRQELIQDLFKEWKDPQ 850 Score = 39.7 bits (91), Expect(2) = 3e-09 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +3 Query: 699 DVTHPHPGEDSCPSIATVI 755 DVTHPHPGEDS PSIA V+ Sbjct: 796 DVTHPHPGEDSSPSIAAVV 814 >ref|XP_002894111.1| hypothetical protein ARALYDRAFT_473977 [Arabidopsis lyrata subsp. lyrata] gi|297339953|gb|EFH70370.1| hypothetical protein ARALYDRAFT_473977 [Arabidopsis lyrata subsp. lyrata] Length = 1052 Score = 48.9 bits (115), Expect(2) = 3e-09 Identities = 24/38 (63%), Positives = 26/38 (68%), Gaps = 6/38 (15%) Frame = +2 Query: 824 VEASQDWPDITKYAGLVCVQDHR------LFKVWHELQ 919 V ASQDWP+ITKYAGLVC Q HR LFK W + Q Sbjct: 781 VVASQDWPEITKYAGLVCAQAHRQELIQDLFKEWKDPQ 818 Score = 39.7 bits (91), Expect(2) = 3e-09 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +3 Query: 699 DVTHPHPGEDSCPSIATVI 755 DVTHPHPGEDS PSIA V+ Sbjct: 764 DVTHPHPGEDSSPSIAAVV 782 >ref|NP_849784.1| protein argonaute [Arabidopsis thaliana] gi|334183151|ref|NP_001185169.1| protein argonaute [Arabidopsis thaliana] gi|332194167|gb|AEE32288.1| protein argonaute [Arabidopsis thaliana] gi|332194168|gb|AEE32289.1| protein argonaute [Arabidopsis thaliana] Length = 1050 Score = 48.9 bits (115), Expect(2) = 3e-09 Identities = 24/38 (63%), Positives = 26/38 (68%), Gaps = 6/38 (15%) Frame = +2 Query: 824 VEASQDWPDITKYAGLVCVQDHR------LFKVWHELQ 919 V ASQDWP+ITKYAGLVC Q HR LFK W + Q Sbjct: 779 VVASQDWPEITKYAGLVCAQAHRQELIQDLFKEWKDPQ 816 Score = 39.7 bits (91), Expect(2) = 3e-09 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +3 Query: 699 DVTHPHPGEDSCPSIATVI 755 DVTHPHPGEDS PSIA V+ Sbjct: 762 DVTHPHPGEDSSPSIAAVV 780