BLASTX nr result
ID: Cimicifuga21_contig00023485
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00023485 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634485.1| PREDICTED: uncharacterized protein LOC100854... 63 3e-08 emb|CAN74014.1| hypothetical protein VITISV_003551 [Vitis vinifera] 63 3e-08 emb|CAN75257.1| hypothetical protein VITISV_001659 [Vitis vinifera] 57 1e-06 ref|XP_003633357.1| PREDICTED: uncharacterized protein LOC100854... 55 6e-06 >ref|XP_003634485.1| PREDICTED: uncharacterized protein LOC100854963 [Vitis vinifera] Length = 151 Score = 62.8 bits (151), Expect = 3e-08 Identities = 34/60 (56%), Positives = 40/60 (66%), Gaps = 7/60 (11%) Frame = -1 Query: 161 MAPHHHLSFILPLLFITFSLMNT-DVNAARHLSE------APELPKPTLPSIPTIPNFPK 3 MA HH S +LPLL IT SLM+ +V A+RHL E PELPKP LP +PT+P FPK Sbjct: 1 MAHHHDQSILLPLLLITLSLMSCKEVFASRHLLEETTLPKVPELPKPELPPLPTLPTFPK 60 >emb|CAN74014.1| hypothetical protein VITISV_003551 [Vitis vinifera] Length = 151 Score = 62.8 bits (151), Expect = 3e-08 Identities = 34/60 (56%), Positives = 40/60 (66%), Gaps = 7/60 (11%) Frame = -1 Query: 161 MAPHHHLSFILPLLFITFSLMNT-DVNAARHLSE------APELPKPTLPSIPTIPNFPK 3 MA HH S +LPLL IT SLM+ +V A+RHL E PELPKP LP +PT+P FPK Sbjct: 1 MAHHHDQSILLPLLLITLSLMSCKEVFASRHLLEETTLPKVPELPKPELPPLPTLPTFPK 60 >emb|CAN75257.1| hypothetical protein VITISV_001659 [Vitis vinifera] Length = 135 Score = 57.4 bits (137), Expect = 1e-06 Identities = 32/59 (54%), Positives = 38/59 (64%), Gaps = 6/59 (10%) Frame = -1 Query: 161 MAPHHHLSFILPLLFITFSLMN-TDVNAARHLSEA-----PELPKPTLPSIPTIPNFPK 3 MA HH S +LPLL IT SLM+ +V A+RHL E PELPK LP +PT+P PK Sbjct: 1 MARHHEPSILLPLLLITLSLMSGKEVLASRHLLETTLPTVPELPKVELPPLPTLPTLPK 59 >ref|XP_003633357.1| PREDICTED: uncharacterized protein LOC100854898 [Vitis vinifera] Length = 135 Score = 55.1 bits (131), Expect = 6e-06 Identities = 31/59 (52%), Positives = 37/59 (62%), Gaps = 6/59 (10%) Frame = -1 Query: 161 MAPHHHLSFILPLLFITFSLMN-TDVNAARHLSEA-----PELPKPTLPSIPTIPNFPK 3 MA HH S +LPLL IT LM+ +V A+RHL E PELPK LP +PT+P PK Sbjct: 1 MARHHEPSILLPLLLITLFLMSGKEVLASRHLLETTLPTVPELPKVELPPLPTLPTLPK 59