BLASTX nr result
ID: Cimicifuga21_contig00023132
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00023132 (631 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535311.1| conserved hypothetical protein [Ricinus comm... 49 4e-10 ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] g... 69 9e-10 ref|XP_002531802.1| conserved hypothetical protein [Ricinus comm... 59 1e-06 >ref|XP_002535311.1| conserved hypothetical protein [Ricinus communis] gi|223523476|gb|EEF27072.1| conserved hypothetical protein [Ricinus communis] Length = 63 Score = 48.5 bits (114), Expect(2) = 4e-10 Identities = 23/30 (76%), Positives = 26/30 (86%), Gaps = 2/30 (6%) Frame = -1 Query: 352 LRWSS--LIFPNVQSCSGLRKEHRPSALNE 269 +RWSS + FPNV+SCSGLRKEHRPS LNE Sbjct: 34 VRWSSRSVGFPNVKSCSGLRKEHRPSTLNE 63 Score = 41.6 bits (96), Expect(2) = 4e-10 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = -3 Query: 455 MLLPADQAATLLVIGVSGLPLTFGSDKSSPLGRFAQV 345 MLLPA AA +S PL+FGSDKSSP GRFAQV Sbjct: 1 MLLPASDAAR---DRLSFKPLSFGSDKSSPFGRFAQV 34 >ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] gi|355477354|gb|AES58557.1| Ribosomal protein S3 [Medicago truncatula] Length = 306 Score = 68.6 bits (166), Expect = 9e-10 Identities = 37/56 (66%), Positives = 37/56 (66%) Frame = +2 Query: 464 MGQRIKRFYFVPRDPPQVGFESRVMGDYPARFGEHL*SALVNGSPLQERSGSSHGG 631 MGQRIKRF FV RD PQVGFESRVMGDYPARFGE SG SHGG Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGE---------------SGYSHGG 41 >ref|XP_002531802.1| conserved hypothetical protein [Ricinus communis] gi|223528568|gb|EEF30590.1| conserved hypothetical protein [Ricinus communis] Length = 72 Score = 58.5 bits (140), Expect = 1e-06 Identities = 32/57 (56%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -1 Query: 601 QGASIHQRRLQVLSEPCWIVTHHTALKPNLW-WIPGDKVKALDPLPHTLRCSSPPIK 434 +G SI Q RL+VL EPC I+T++T GD VKALDPLPHTL+ SS PIK Sbjct: 16 RGPSIQQCRLKVLCEPCRIITYYTTHSSQTCDGSQGDNVKALDPLPHTLKGSSTPIK 72