BLASTX nr result
ID: Cimicifuga21_contig00023130
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00023130 (484 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABP01766.1| proteinase inhibitor 1 [Salvia miltiorrhiza] 70 2e-10 ref|XP_003535093.1| PREDICTED: glu S.griseus protease inhibitor-... 67 2e-09 ref|XP_002521007.1| Proteinase inhibitor, putative [Ricinus comm... 64 2e-08 ref|XP_002521006.1| Proteinase inhibitor, putative [Ricinus comm... 63 3e-08 ref|NP_001238694.1| protease inhibitor-like [Glycine max] gi|168... 63 3e-08 >gb|ABP01766.1| proteinase inhibitor 1 [Salvia miltiorrhiza] Length = 73 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/66 (48%), Positives = 44/66 (66%) Frame = +2 Query: 140 DIKKFEWPELVGVKADIAMAAIERDNPYVTVLKIKPHYMVTLDVCCNRVWLFVDGKDVVN 319 D+ K WPELVGV D+A+A IE++NP V + I P + T + C+RV +FVD +VN Sbjct: 8 DVGKSSWPELVGVAGDVAVATIEKENPSVNAVVITPETVWTPAIFCDRVLVFVDANGIVN 67 Query: 320 AVPKVG 337 +VP VG Sbjct: 68 SVPTVG 73 >ref|XP_003535093.1| PREDICTED: glu S.griseus protease inhibitor-like, partial [Glycine max] Length = 71 Score = 66.6 bits (161), Expect = 2e-09 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 2/71 (2%) Frame = +2 Query: 131 FPADI--KKFEWPELVGVKADIAMAAIERDNPYVTVLKIKPHYMVTLDVCCNRVWLFVDG 304 F AD+ KF WPELVGV+ +A A IER+NP V + + +VT D+ +RVW++V+ Sbjct: 1 FDADLCAGKFSWPELVGVQGTVAEATIERENPSVNAIIVPLGSVVTTDLRSDRVWVWVNK 60 Query: 305 KDVVNAVPKVG 337 +VN VPK+G Sbjct: 61 DGIVNRVPKIG 71 >ref|XP_002521007.1| Proteinase inhibitor, putative [Ricinus communis] gi|223539844|gb|EEF41424.1| Proteinase inhibitor, putative [Ricinus communis] Length = 70 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/63 (47%), Positives = 38/63 (60%) Frame = +2 Query: 149 KFEWPELVGVKADIAMAAIERDNPYVTVLKIKPHYMVTLDVCCNRVWLFVDGKDVVNAVP 328 K WPELVG K D A A +E++N +V + +K VT D CNRVW++VD VV P Sbjct: 8 KDSWPELVGAKGDDAAATVEKENKHVHAIVLKEGTPVTRDFRCNRVWVWVDENGVVTRAP 67 Query: 329 KVG 337 K G Sbjct: 68 KTG 70 >ref|XP_002521006.1| Proteinase inhibitor, putative [Ricinus communis] gi|223539843|gb|EEF41423.1| Proteinase inhibitor, putative [Ricinus communis] Length = 69 Score = 62.8 bits (151), Expect = 3e-08 Identities = 30/63 (47%), Positives = 38/63 (60%) Frame = +2 Query: 149 KFEWPELVGVKADIAMAAIERDNPYVTVLKIKPHYMVTLDVCCNRVWLFVDGKDVVNAVP 328 K WPELVG D A AAIE++N YV + +K VT D C+RVW++VD VV P Sbjct: 7 KNSWPELVGANGDEAAAAIEKENKYVDAIVLKEGTPVTKDFRCSRVWVWVDENGVVTRTP 66 Query: 329 KVG 337 +G Sbjct: 67 TIG 69 >ref|NP_001238694.1| protease inhibitor-like [Glycine max] gi|168259030|gb|ACA23204.1| putative protease inhibitor [Glycine max] Length = 70 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/63 (44%), Positives = 39/63 (61%) Frame = +2 Query: 149 KFEWPELVGVKADIAMAAIERDNPYVTVLKIKPHYMVTLDVCCNRVWLFVDGKDVVNAVP 328 K WPELVGV+ +A A IER+NP V + + MV D C+RVW+++D +V VP Sbjct: 8 KSSWPELVGVQGTVAEATIERENPLVDAIIVPEGNMVITDFRCDRVWVWIDKDGIVKEVP 67 Query: 329 KVG 337 +G Sbjct: 68 HIG 70