BLASTX nr result
ID: Cimicifuga21_contig00022935
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00022935 (433 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529445.1| esophageal cancer associated protein, putati... 55 6e-06 ref|XP_002277652.2| PREDICTED: UPF0505 protein C16orf62 homolog ... 55 8e-06 emb|CBI26668.3| unnamed protein product [Vitis vinifera] 55 8e-06 emb|CAN66283.1| hypothetical protein VITISV_003049 [Vitis vinifera] 55 8e-06 >ref|XP_002529445.1| esophageal cancer associated protein, putative [Ricinus communis] gi|223531061|gb|EEF32911.1| esophageal cancer associated protein, putative [Ricinus communis] Length = 925 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/44 (54%), Positives = 34/44 (77%) Frame = -1 Query: 433 CILSSFKASIEISQICSKLIEIAKSCLNPNDNYLRSTMRFLDKH 302 CI SFK S +I Q+C KLIE A+ CL+ ND +L+ST+++LD+H Sbjct: 870 CIALSFKVSEDILQVCWKLIETAELCLSTNDRFLQSTIKYLDEH 913 >ref|XP_002277652.2| PREDICTED: UPF0505 protein C16orf62 homolog [Vitis vinifera] Length = 920 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -1 Query: 433 CILSSFKASIEISQICSKLIEIAKSCLNPNDNYLRSTMRFL 311 CI SSFK S EIS ICSKL+E A+ CL+ N+ YL+STM+ L Sbjct: 864 CIASSFKVSPEISPICSKLMETAQLCLSSNNKYLQSTMKLL 904 >emb|CBI26668.3| unnamed protein product [Vitis vinifera] Length = 810 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -1 Query: 433 CILSSFKASIEISQICSKLIEIAKSCLNPNDNYLRSTMRFL 311 CI SSFK S EIS ICSKL+E A+ CL+ N+ YL+STM+ L Sbjct: 754 CIASSFKVSPEISPICSKLMETAQLCLSSNNKYLQSTMKLL 794 >emb|CAN66283.1| hypothetical protein VITISV_003049 [Vitis vinifera] Length = 510 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -1 Query: 433 CILSSFKASIEISQICSKLIEIAKSCLNPNDNYLRSTMRFL 311 CI SSFK S EIS ICSKL+E A+ CL+ N+ YL+STM+ L Sbjct: 454 CIASSFKVSPEISPICSKLMETAQLCLSSNNKYLQSTMKLL 494