BLASTX nr result
ID: Cimicifuga21_contig00022519
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00022519 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004147006.1| PREDICTED: auxin-induced protein 10A5-like [... 65 7e-09 ref|XP_002271395.1| PREDICTED: auxin-induced protein 10A5 [Vitis... 64 1e-08 emb|CAN79758.1| hypothetical protein VITISV_009898 [Vitis vinifera] 64 1e-08 ref|XP_002306152.1| SAUR family protein [Populus trichocarpa] gi... 62 4e-08 ref|NP_195595.1| SAUR-like auxin-responsive protein [Arabidopsis... 62 5e-08 >ref|XP_004147006.1| PREDICTED: auxin-induced protein 10A5-like [Cucumis sativus] Length = 97 Score = 64.7 bits (156), Expect = 7e-09 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 329 LLSRAEEEFGFNHPMGGLTIPCKEETFADIASR 231 LL RAEEEFGFNHPMGGLTIPC+EETF D+ SR Sbjct: 61 LLKRAEEEFGFNHPMGGLTIPCREETFIDLTSR 93 >ref|XP_002271395.1| PREDICTED: auxin-induced protein 10A5 [Vitis vinifera] gi|297735263|emb|CBI17625.3| unnamed protein product [Vitis vinifera] Length = 97 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 329 LLSRAEEEFGFNHPMGGLTIPCKEETFADIASR 231 LL +AEEEFGF+HPMGGLTIPCKEETF D+ASR Sbjct: 61 LLQQAEEEFGFDHPMGGLTIPCKEETFVDLASR 93 >emb|CAN79758.1| hypothetical protein VITISV_009898 [Vitis vinifera] Length = 80 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 329 LLSRAEEEFGFNHPMGGLTIPCKEETFADIASR 231 LL +AEEEFGF+HPMGGLTIPCKEETF D+ASR Sbjct: 44 LLQQAEEEFGFDHPMGGLTIPCKEETFVDLASR 76 >ref|XP_002306152.1| SAUR family protein [Populus trichocarpa] gi|222849116|gb|EEE86663.1| SAUR family protein [Populus trichocarpa] Length = 99 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 329 LLSRAEEEFGFNHPMGGLTIPCKEETFADIAS 234 LLS+AEEEFGFNHPMGGLTIPC+E+TF DI S Sbjct: 63 LLSKAEEEFGFNHPMGGLTIPCREDTFIDILS 94 >ref|NP_195595.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana] gi|4490336|emb|CAB38618.1| auxin-induced protein-like [Arabidopsis thaliana] gi|7270867|emb|CAB80547.1| auxin-induced protein-like [Arabidopsis thaliana] gi|62321722|dbj|BAD95347.1| auxin-induced protein - like [Arabidopsis thaliana] gi|88010988|gb|ABD38883.1| At4g38840 [Arabidopsis thaliana] gi|225898869|dbj|BAH30565.1| hypothetical protein [Arabidopsis thaliana] gi|332661582|gb|AEE86982.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana] Length = 99 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -2 Query: 329 LLSRAEEEFGFNHPMGGLTIPCKEETFADIASRF 228 LL +AEEEFGF+HPMGGLTIPC EE F D+ASRF Sbjct: 65 LLRKAEEEFGFDHPMGGLTIPCSEEIFIDLASRF 98