BLASTX nr result
ID: Cimicifuga21_contig00022471
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00022471 (332 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002453528.1| hypothetical protein SORBIDRAFT_04g007410 [S... 87 1e-15 ref|XP_002461954.1| hypothetical protein SORBIDRAFT_02g011140 [S... 87 1e-15 ref|XP_002468514.1| hypothetical protein SORBIDRAFT_01g047190 [S... 87 2e-15 ref|XP_002438303.1| hypothetical protein SORBIDRAFT_10g011520 [S... 87 2e-15 ref|XP_002447507.1| hypothetical protein SORBIDRAFT_06g002230 [S... 85 5e-15 >ref|XP_002453528.1| hypothetical protein SORBIDRAFT_04g007410 [Sorghum bicolor] gi|241933359|gb|EES06504.1| hypothetical protein SORBIDRAFT_04g007410 [Sorghum bicolor] Length = 708 Score = 87.0 bits (214), Expect = 1e-15 Identities = 45/98 (45%), Positives = 65/98 (66%), Gaps = 1/98 (1%) Frame = -2 Query: 331 EALKHKEERYKPILDIVDAKGKGRIDTPLHLTAYLLNPYYYFNLGSTWSTDESEIVMDGV 152 EAL + E R+K ++ +VD K KGR+D+PLHLTAYLLNP+Y + + S + + +G Sbjct: 434 EALGNIESRFKEVIAVVDKKTKGRLDSPLHLTAYLLNPHYSY---ANPSIFDEPTITEGF 490 Query: 151 FACIERL-YPDLNMQDKVINVELVKYKNREGAFGKALA 41 +C+E Y D + QD+ +VEL K++NREG F K LA Sbjct: 491 ISCVETFYYHDEDKQDQAAHVELRKFQNREGPFNKKLA 528 >ref|XP_002461954.1| hypothetical protein SORBIDRAFT_02g011140 [Sorghum bicolor] gi|241925331|gb|EER98475.1| hypothetical protein SORBIDRAFT_02g011140 [Sorghum bicolor] Length = 759 Score = 87.0 bits (214), Expect = 1e-15 Identities = 45/98 (45%), Positives = 65/98 (66%), Gaps = 1/98 (1%) Frame = -2 Query: 331 EALKHKEERYKPILDIVDAKGKGRIDTPLHLTAYLLNPYYYFNLGSTWSTDESEIVMDGV 152 EAL + E R+K ++ +VD K KGR+D+PLHLTAYLLNP+Y + + S + + +G Sbjct: 485 EALGNIESRFKEVIAVVDKKTKGRLDSPLHLTAYLLNPHYSY---ANPSIFDEPTITEGF 541 Query: 151 FACIERL-YPDLNMQDKVINVELVKYKNREGAFGKALA 41 +C+E Y D + QD+ +VEL K++NREG F K LA Sbjct: 542 ISCVETFYYHDEDKQDQAAHVELRKFQNREGPFNKKLA 579 >ref|XP_002468514.1| hypothetical protein SORBIDRAFT_01g047190 [Sorghum bicolor] gi|241922368|gb|EER95512.1| hypothetical protein SORBIDRAFT_01g047190 [Sorghum bicolor] Length = 759 Score = 86.7 bits (213), Expect = 2e-15 Identities = 45/98 (45%), Positives = 65/98 (66%), Gaps = 1/98 (1%) Frame = -2 Query: 331 EALKHKEERYKPILDIVDAKGKGRIDTPLHLTAYLLNPYYYFNLGSTWSTDESEIVMDGV 152 EAL + E R+K ++ +VD K KGR+D+PLHLTAYLLNP+Y + + S + + +G Sbjct: 485 EALGNIESRFKEVIAVVDKKMKGRLDSPLHLTAYLLNPHYSY---ANPSIFDEPTITEGF 541 Query: 151 FACIERL-YPDLNMQDKVINVELVKYKNREGAFGKALA 41 +C+E Y D + QD+ +VEL K++NREG F K LA Sbjct: 542 ISCVETFYYHDEDKQDQAAHVELRKFQNREGPFNKKLA 579 >ref|XP_002438303.1| hypothetical protein SORBIDRAFT_10g011520 [Sorghum bicolor] gi|241916526|gb|EER89670.1| hypothetical protein SORBIDRAFT_10g011520 [Sorghum bicolor] Length = 759 Score = 86.7 bits (213), Expect = 2e-15 Identities = 45/98 (45%), Positives = 65/98 (66%), Gaps = 1/98 (1%) Frame = -2 Query: 331 EALKHKEERYKPILDIVDAKGKGRIDTPLHLTAYLLNPYYYFNLGSTWSTDESEIVMDGV 152 EAL + E R+K ++ +VD K KGR+D+PLHLTAYLLNP+Y + + S + + +G Sbjct: 485 EALGNIESRFKEVIAVVDKKMKGRLDSPLHLTAYLLNPHYSY---ANPSIFDEPTITEGF 541 Query: 151 FACIERL-YPDLNMQDKVINVELVKYKNREGAFGKALA 41 +C+E Y D + QD+ +VEL K++NREG F K LA Sbjct: 542 ISCVETFYYHDEDKQDQAAHVELRKFQNREGPFNKKLA 579 >ref|XP_002447507.1| hypothetical protein SORBIDRAFT_06g002230 [Sorghum bicolor] gi|241938690|gb|EES11835.1| hypothetical protein SORBIDRAFT_06g002230 [Sorghum bicolor] Length = 311 Score = 85.1 bits (209), Expect = 5e-15 Identities = 42/92 (45%), Positives = 62/92 (67%), Gaps = 1/92 (1%) Frame = -2 Query: 313 EERYKPILDIVDAKGKGRIDTPLHLTAYLLNPYYYFNLGSTWSTDESEIVMDGVFACIER 134 E R+K ++ +VD K GR+D+PLHLTAYLLNP+Y ++ S + + + +G AC+E+ Sbjct: 41 EARFKDVIAVVDKKMNGRLDSPLHLTAYLLNPHYSYSDPSIFDQPK---ISEGFIACVEK 97 Query: 133 L-YPDLNMQDKVINVELVKYKNREGAFGKALA 41 Y D +MQ + N+EL K++NREG F K LA Sbjct: 98 FYYHDEDMQHQAANIELKKFQNREGPFSKKLA 129