BLASTX nr result
ID: Cimicifuga21_contig00022306
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00022306 (479 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277244.1| PREDICTED: histidine biosynthesis bifunction... 69 5e-10 ref|XP_002443519.1| hypothetical protein SORBIDRAFT_08g020870 [S... 67 1e-09 ref|XP_003567089.1| PREDICTED: histidine biosynthesis bifunction... 67 2e-09 dbj|BAK00303.1| predicted protein [Hordeum vulgare subsp. vulgare] 67 2e-09 ref|XP_002457646.1| hypothetical protein SORBIDRAFT_03g011110 [S... 67 2e-09 >ref|XP_002277244.1| PREDICTED: histidine biosynthesis bifunctional protein hisIE, chloroplastic [Vitis vinifera] gi|296082253|emb|CBI21258.3| unnamed protein product [Vitis vinifera] Length = 289 Score = 68.6 bits (166), Expect = 5e-10 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = -3 Query: 477 AEAADLIFHSMVLLKNKDVKLEEVLQVLRRRFSQSGIEEKNSRRSHG 337 +E AD+++H+MVLL KDVK+EEVLQVLR RFSQSGIEEK SR + G Sbjct: 243 SEMADVLYHTMVLLSLKDVKMEEVLQVLRHRFSQSGIEEKKSRATQG 289 >ref|XP_002443519.1| hypothetical protein SORBIDRAFT_08g020870 [Sorghum bicolor] gi|241944212|gb|EES17357.1| hypothetical protein SORBIDRAFT_08g020870 [Sorghum bicolor] Length = 306 Score = 67.0 bits (162), Expect = 1e-09 Identities = 32/43 (74%), Positives = 40/43 (93%) Frame = -3 Query: 477 AEAADLIFHSMVLLKNKDVKLEEVLQVLRRRFSQSGIEEKNSR 349 +E ADL++H+MVLL+ KDVK+EEVL+VLR+RFSQSGIEEK SR Sbjct: 261 SEMADLLYHAMVLLRVKDVKMEEVLEVLRKRFSQSGIEEKASR 303 >ref|XP_003567089.1| PREDICTED: histidine biosynthesis bifunctional protein hisIE, chloroplastic-like [Brachypodium distachyon] Length = 297 Score = 66.6 bits (161), Expect = 2e-09 Identities = 31/44 (70%), Positives = 40/44 (90%) Frame = -3 Query: 477 AEAADLIFHSMVLLKNKDVKLEEVLQVLRRRFSQSGIEEKNSRR 346 +E ADL++H+MVLL KDVK+EEVL+VLR+RFSQSG+EEK SR+ Sbjct: 252 SEMADLLYHAMVLLSVKDVKMEEVLEVLRKRFSQSGVEEKASRK 295 >dbj|BAK00303.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 298 Score = 66.6 bits (161), Expect = 2e-09 Identities = 31/44 (70%), Positives = 40/44 (90%) Frame = -3 Query: 477 AEAADLIFHSMVLLKNKDVKLEEVLQVLRRRFSQSGIEEKNSRR 346 +E ADL++H+MVLL KDVK+EEVL+VLR+RFSQSG+EEK SR+ Sbjct: 253 SEMADLLYHAMVLLSVKDVKMEEVLEVLRKRFSQSGVEEKASRK 296 >ref|XP_002457646.1| hypothetical protein SORBIDRAFT_03g011110 [Sorghum bicolor] gi|241929621|gb|EES02766.1| hypothetical protein SORBIDRAFT_03g011110 [Sorghum bicolor] Length = 297 Score = 66.6 bits (161), Expect = 2e-09 Identities = 31/43 (72%), Positives = 40/43 (93%) Frame = -3 Query: 477 AEAADLIFHSMVLLKNKDVKLEEVLQVLRRRFSQSGIEEKNSR 349 +E ADL++H+MVLL+ KDVK+EEVL++LR+RFSQSGIEEK SR Sbjct: 252 SEMADLLYHAMVLLRVKDVKMEEVLEILRKRFSQSGIEEKASR 294