BLASTX nr result
ID: Cimicifuga21_contig00022273
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00022273 (642 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003520004.1| PREDICTED: putative pentatricopeptide repeat... 64 3e-08 gb|AAF88095.1|AC025417_23 T12C24.15 [Arabidopsis thaliana] 63 4e-08 ref|NP_563911.1| pentatricopeptide repeat-containing protein [Ar... 63 4e-08 gb|AAF79658.1|AC025416_32 F5O11.4 [Arabidopsis thaliana] 62 9e-08 ref|NP_172694.1| pentatricopeptide repeat-containing protein [Ar... 62 9e-08 >ref|XP_003520004.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial-like [Glycine max] Length = 525 Score = 63.5 bits (153), Expect = 3e-08 Identities = 33/74 (44%), Positives = 46/74 (62%) Frame = +1 Query: 76 CSAKQQN*TRENELFCILPTK*LQPATRTYNTMIDGFCKEGMLNDVQNLFTEMEQKGIDP 255 CS + N RE LF LP+K +Q Y TMI G CKEG+L+D ++L +ME+ G P Sbjct: 404 CSFGKFNDARE--LFSCLPSKGIQIDVVAYTTMIKGLCKEGLLDDAEDLLMKMEENGCPP 461 Query: 256 NDHTFNILVTFIWQ 297 N+ T+N+LV + Q Sbjct: 462 NEFTYNVLVRGLLQ 475 >gb|AAF88095.1|AC025417_23 T12C24.15 [Arabidopsis thaliana] Length = 735 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/57 (49%), Positives = 39/57 (68%) Frame = +1 Query: 112 ELFCILPTK*LQPATRTYNTMIDGFCKEGMLNDVQNLFTEMEQKGIDPNDHTFNILV 282 +LFC LP K ++P +TYN MI G CK+G L++ LF +ME+ G PN T+NIL+ Sbjct: 513 DLFCSLPLKGVKPDVKTYNIMIGGLCKKGSLSEADLLFRKMEEDGHSPNGCTYNILI 569 >ref|NP_563911.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75167758|sp|Q9ASZ8.1|PPR37_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g12620 gi|13605505|gb|AAK32746.1|AF361578_1 At1g12620/T12C24_25 [Arabidopsis thaliana] gi|24111307|gb|AAN46777.1| At1g12620/T12C24_25 [Arabidopsis thaliana] gi|332190781|gb|AEE28902.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 621 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/57 (49%), Positives = 39/57 (68%) Frame = +1 Query: 112 ELFCILPTK*LQPATRTYNTMIDGFCKEGMLNDVQNLFTEMEQKGIDPNDHTFNILV 282 +LFC LP K ++P +TYN MI G CK+G L++ LF +ME+ G PN T+NIL+ Sbjct: 513 DLFCSLPLKGVKPDVKTYNIMIGGLCKKGSLSEADLLFRKMEEDGHSPNGCTYNILI 569 >gb|AAF79658.1|AC025416_32 F5O11.4 [Arabidopsis thaliana] Length = 975 Score = 62.0 bits (149), Expect = 9e-08 Identities = 27/57 (47%), Positives = 40/57 (70%) Frame = +1 Query: 112 ELFCILPTK*LQPATRTYNTMIDGFCKEGMLNDVQNLFTEMEQKGIDPNDHTFNILV 282 +LFC LP K ++P +TYN MI G CK+G L++ + LF +ME+ G P+ T+NIL+ Sbjct: 627 DLFCSLPLKGVKPGVKTYNIMIGGLCKKGPLSEAELLFRKMEEDGHAPDGWTYNILI 683 >ref|NP_172694.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|122242333|sp|Q0WKV3.1|PPR36_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g12300, mitochondrial; Flags: Precursor gi|110741411|dbj|BAF02254.1| hypothetical protein [Arabidopsis thaliana] gi|332190743|gb|AEE28864.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 637 Score = 62.0 bits (149), Expect = 9e-08 Identities = 27/57 (47%), Positives = 40/57 (70%) Frame = +1 Query: 112 ELFCILPTK*LQPATRTYNTMIDGFCKEGMLNDVQNLFTEMEQKGIDPNDHTFNILV 282 +LFC LP K ++P +TYN MI G CK+G L++ + LF +ME+ G P+ T+NIL+ Sbjct: 529 DLFCSLPLKGVKPGVKTYNIMIGGLCKKGPLSEAELLFRKMEEDGHAPDGWTYNILI 585