BLASTX nr result
ID: Cimicifuga21_contig00022260
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00022260 (281 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523074.1| beta-glucosidase, putative [Ricinus communis... 55 4e-06 >ref|XP_002523074.1| beta-glucosidase, putative [Ricinus communis] gi|223537636|gb|EEF39259.1| beta-glucosidase, putative [Ricinus communis] Length = 193 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -3 Query: 279 PKLSAHWYSDFLKGRGFNSDKIIRLGKNSSSLSRTSYF 166 PKLSAHWYS FLKG +SDK I+LGK+SS LS+ +F Sbjct: 155 PKLSAHWYSHFLKGGSVSSDKFIQLGKDSSLLSKNRFF 192