BLASTX nr result
ID: Cimicifuga21_contig00021336
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00021336 (273 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002451378.1| hypothetical protein SORBIDRAFT_04g001070 [S... 58 9e-07 ref|XP_002442909.1| hypothetical protein SORBIDRAFT_08g004750 [S... 55 5e-06 >ref|XP_002451378.1| hypothetical protein SORBIDRAFT_04g001070 [Sorghum bicolor] gi|241931209|gb|EES04354.1| hypothetical protein SORBIDRAFT_04g001070 [Sorghum bicolor] Length = 503 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/50 (52%), Positives = 37/50 (74%) Frame = +2 Query: 104 RCGGGGGLKRTSISVGGQIPQELIADILKRLPLKSQCRFKCVSKSWRALI 253 + G GGG + + Q+P+++I D+L RLP+K+ CRF+CVSKSWRALI Sbjct: 35 KLGLGGGGDQHPDAEPPQLPEDIIFDVLSRLPVKTLCRFRCVSKSWRALI 84 >ref|XP_002442909.1| hypothetical protein SORBIDRAFT_08g004750 [Sorghum bicolor] gi|241943602|gb|EES16747.1| hypothetical protein SORBIDRAFT_08g004750 [Sorghum bicolor] Length = 311 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/46 (54%), Positives = 32/46 (69%) Frame = +2 Query: 122 GLKRTSISVGGQIPQELIADILKRLPLKSQCRFKCVSKSWRALIID 259 G R + + +P ELI +IL RLP KS CRFKCVS++WR+LI D Sbjct: 4 GSCRAAAAAAAVLPDELIVEILARLPAKSLCRFKCVSRAWRSLISD 49