BLASTX nr result
ID: Cimicifuga21_contig00020996
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00020996 (317 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002884507.1| pentatricopeptide repeat-containing protein ... 79 5e-13 ref|NP_187185.2| pentatricopeptide repeat-containing protein [Ar... 78 7e-13 gb|AAF27040.1|AC009177_30 hypothetical protein [Arabidopsis thal... 78 7e-13 ref|XP_002280725.1| PREDICTED: pentatricopeptide repeat-containi... 70 2e-10 ref|XP_004156421.1| PREDICTED: putative pentatricopeptide repeat... 64 1e-08 >ref|XP_002884507.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297330347|gb|EFH60766.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 676 Score = 78.6 bits (192), Expect = 5e-13 Identities = 45/91 (49%), Positives = 53/91 (58%), Gaps = 1/91 (1%) Frame = +1 Query: 46 MKARWAIANFNSHLPSSTLSSFIRKKFKLSLNPLLDYHNSDFSLDHVDMSTLLSICGKEG 225 M +RW I SHLPS + K + +P Y S F L+HVDMS LLSICG+EG Sbjct: 1 MNSRWVIQKLTSHLPSCFSTVLSPSKILIRQSP--SYQVSTFLLNHVDMSLLLSICGREG 58 Query: 226 YF-RLGASLHVSIVKNYEYFDPTFQPNSRNA 315 +F LG LH SIVKN E+FDP RNA Sbjct: 59 WFPYLGPCLHASIVKNPEFFDPVDADIHRNA 89 >ref|NP_187185.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|218546760|sp|Q9MA85.2|PP215_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g05340 gi|332640702|gb|AEE74223.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 658 Score = 78.2 bits (191), Expect = 7e-13 Identities = 43/91 (47%), Positives = 54/91 (59%), Gaps = 1/91 (1%) Frame = +1 Query: 46 MKARWAIANFNSHLPSSTLSSFIRKKFKLSLNPLLDYHNSDFSLDHVDMSTLLSICGKEG 225 M +RW I SHLPS + K + +P +Y S F L+HVDMS LLSICG+EG Sbjct: 1 MNSRWVIQKLTSHLPSCLSTVLSPSKILIRQSP--NYQVSTFLLNHVDMSLLLSICGREG 58 Query: 226 YF-RLGASLHVSIVKNYEYFDPTFQPNSRNA 315 +F LG LH SI+KN E+F+P RNA Sbjct: 59 WFPHLGPCLHASIIKNPEFFEPVDADIHRNA 89 >gb|AAF27040.1|AC009177_30 hypothetical protein [Arabidopsis thaliana] Length = 770 Score = 78.2 bits (191), Expect = 7e-13 Identities = 43/91 (47%), Positives = 54/91 (59%), Gaps = 1/91 (1%) Frame = +1 Query: 46 MKARWAIANFNSHLPSSTLSSFIRKKFKLSLNPLLDYHNSDFSLDHVDMSTLLSICGKEG 225 M +RW I SHLPS + K + +P +Y S F L+HVDMS LLSICG+EG Sbjct: 1 MNSRWVIQKLTSHLPSCLSTVLSPSKILIRQSP--NYQVSTFLLNHVDMSLLLSICGREG 58 Query: 226 YF-RLGASLHVSIVKNYEYFDPTFQPNSRNA 315 +F LG LH SI+KN E+F+P RNA Sbjct: 59 WFPHLGPCLHASIIKNPEFFEPVDADIHRNA 89 >ref|XP_002280725.1| PREDICTED: pentatricopeptide repeat-containing protein At3g05340 [Vitis vinifera] Length = 656 Score = 70.1 bits (170), Expect = 2e-10 Identities = 37/89 (41%), Positives = 51/89 (57%) Frame = +1 Query: 46 MKARWAIANFNSHLPSSTLSSFIRKKFKLSLNPLLDYHNSDFSLDHVDMSTLLSICGKEG 225 MK +W NS LP T K + NP + S F+++ VD+S LLS+CG+EG Sbjct: 1 MKPKWFFQKLNSFLPYCTSPVSSPLKTLILQNPYSE--TSKFAINQVDISFLLSLCGREG 58 Query: 226 YFRLGASLHVSIVKNYEYFDPTFQPNSRN 312 Y LG+SLH SI+KN+ + D + N RN Sbjct: 59 YLHLGSSLHASIIKNFGFLDGNNRDNLRN 87 >ref|XP_004156421.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g68930-like [Cucumis sativus] Length = 833 Score = 63.9 bits (154), Expect = 1e-08 Identities = 34/77 (44%), Positives = 47/77 (61%) Frame = +1 Query: 46 MKARWAIANFNSHLPSSTLSSFIRKKFKLSLNPLLDYHNSDFSLDHVDMSTLLSICGKEG 225 MK +W +SHLPS S + + NP + +S F L+H+D S LLSICG+EG Sbjct: 1 MKLKWVFQKRSSHLPSWVTSLISPFRNQFHQNPFPET-SSTFVLNHLDPSFLLSICGREG 59 Query: 226 YFRLGASLHVSIVKNYE 276 LG+SLH SI+K++E Sbjct: 60 NLHLGSSLHASIIKSFE 76