BLASTX nr result
ID: Cimicifuga21_contig00020841
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00020841 (449 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276327.1| PREDICTED: pentatricopeptide repeat-containi... 79 5e-13 >ref|XP_002276327.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Vitis vinifera] Length = 728 Score = 78.6 bits (192), Expect = 5e-13 Identities = 42/102 (41%), Positives = 61/102 (59%) Frame = +3 Query: 144 YAHQHIHSHGYPLFRYAFSTVGSIDINSKNPQFELENRIKSLCEKPNSQFVEAMTLFSNA 323 + H H+ S L FS+ I I+ +LE +++SLC+KPNSQF EA++LF +A Sbjct: 10 HLHPHLPSQSLYLCFNLFSSSIPIPISPN----DLETQLRSLCQKPNSQFTEAVSLFHSA 65 Query: 324 IHSGPTPFPSTCIFLVDTLGKSKQYSLAISAYNQMTRIGLLP 449 + P +TC FLVD L +S+ Y LA S Y +MT + +LP Sbjct: 66 LDFNLLPSWATCNFLVDALARSRNYGLAFSVYRRMTHVDVLP 107