BLASTX nr result
ID: Cimicifuga21_contig00020792
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00020792 (304 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531136.1| conserved hypothetical protein [Ricinus comm... 82 3e-14 ref|XP_002277720.1| PREDICTED: methyltransferase-like protein 23... 79 3e-13 ref|XP_003573493.1| PREDICTED: methyltransferase-like protein 23... 79 4e-13 ref|XP_002451411.1| hypothetical protein SORBIDRAFT_04g001620 [S... 77 1e-12 gb|EEC72368.1| hypothetical protein OsI_05627 [Oryza sativa Indi... 77 1e-12 >ref|XP_002531136.1| conserved hypothetical protein [Ricinus communis] gi|223529249|gb|EEF31221.1| conserved hypothetical protein [Ricinus communis] Length = 238 Score = 82.4 bits (202), Expect = 3e-14 Identities = 38/51 (74%), Positives = 43/51 (84%) Frame = +1 Query: 1 SGHHLIEYLMIKWNLKCTRLLDAFSFMPSCKASGLTGNIQLAEITWNDPTT 153 SGHHLIE+LM+KW LKC +LLD FSFMPS KASGL+GNIQLAEI N+ T Sbjct: 179 SGHHLIEFLMVKWGLKCVKLLDGFSFMPSHKASGLSGNIQLAEIMLNNEQT 229 >ref|XP_002277720.1| PREDICTED: methyltransferase-like protein 23 [Vitis vinifera] gi|296084695|emb|CBI25837.3| unnamed protein product [Vitis vinifera] Length = 236 Score = 79.3 bits (194), Expect = 3e-13 Identities = 36/47 (76%), Positives = 41/47 (87%) Frame = +1 Query: 1 SGHHLIEYLMIKWNLKCTRLLDAFSFMPSCKASGLTGNIQLAEITWN 141 SGHHLIE+LM+KW LKC +LLD FSFMPS KASGL+G+IQLAEI N Sbjct: 185 SGHHLIEFLMVKWGLKCVKLLDGFSFMPSDKASGLSGSIQLAEIVLN 231 >ref|XP_003573493.1| PREDICTED: methyltransferase-like protein 23-like [Brachypodium distachyon] Length = 240 Score = 79.0 bits (193), Expect = 4e-13 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = +1 Query: 1 SGHHLIEYLMIKWNLKCTRLLDAFSFMPSCKASGLTGNIQLAEIT 135 SGHHLIE+LM+KW LKC +LLD FSF+PSCKA+ L GNIQL EIT Sbjct: 189 SGHHLIEFLMVKWGLKCLKLLDGFSFLPSCKAASLQGNIQLVEIT 233 >ref|XP_002451411.1| hypothetical protein SORBIDRAFT_04g001620 [Sorghum bicolor] gi|241931242|gb|EES04387.1| hypothetical protein SORBIDRAFT_04g001620 [Sorghum bicolor] Length = 220 Score = 77.0 bits (188), Expect = 1e-12 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = +1 Query: 1 SGHHLIEYLMIKWNLKCTRLLDAFSFMPSCKASGLTGNIQLAEIT 135 SGHHLIE+LM+KW LKC +LLD FSF+P CKA+ L GNIQL EIT Sbjct: 169 SGHHLIEFLMVKWGLKCLKLLDGFSFLPPCKAASLQGNIQLVEIT 213 >gb|EEC72368.1| hypothetical protein OsI_05627 [Oryza sativa Indica Group] Length = 253 Score = 77.0 bits (188), Expect = 1e-12 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = +1 Query: 1 SGHHLIEYLMIKWNLKCTRLLDAFSFMPSCKASGLTGNIQLAEI 132 SGHHLIE+LM+KW LKC +LLD FSF+PSCKA+ L GNIQL EI Sbjct: 193 SGHHLIEFLMVKWGLKCLKLLDGFSFLPSCKAASLQGNIQLVEI 236