BLASTX nr result
ID: Cimicifuga21_contig00020732
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00020732 (667 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002325830.1| predicted protein [Populus trichocarpa] gi|2... 60 3e-07 ref|XP_002948268.1| TATA-box binding protein [Volvox carteri f. ... 57 3e-06 ref|XP_001691004.1| global transcription factor [Chlamydomonas r... 57 3e-06 gb|AAV53354.1| TATA-box binding protein [Volvox carteri f. nagar... 57 3e-06 ref|XP_004144066.1| PREDICTED: TATA-box-binding protein-like [Cu... 56 5e-06 >ref|XP_002325830.1| predicted protein [Populus trichocarpa] gi|222862705|gb|EEF00212.1| predicted protein [Populus trichocarpa] Length = 70 Score = 60.5 bits (145), Expect = 3e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 88 LVQYEPELFPGLIYRMKQPKIVLLIFVSG 2 LVQYEPE+FPGLIYRMKQPKIVLLIFVSG Sbjct: 9 LVQYEPEIFPGLIYRMKQPKIVLLIFVSG 37 >ref|XP_002948268.1| TATA-box binding protein [Volvox carteri f. nagariensis] gi|300266488|gb|EFJ50675.1| TATA-box binding protein [Volvox carteri f. nagariensis] Length = 338 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -1 Query: 91 MLVQYEPELFPGLIYRMKQPKIVLLIFVSG 2 + YEPELFPGLIYRMKQPKIVLLIFVSG Sbjct: 126 LFASYEPELFPGLIYRMKQPKIVLLIFVSG 155 >ref|XP_001691004.1| global transcription factor [Chlamydomonas reinhardtii] gi|158279690|gb|EDP05450.1| global transcription factor [Chlamydomonas reinhardtii] Length = 325 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -1 Query: 91 MLVQYEPELFPGLIYRMKQPKIVLLIFVSG 2 + YEPELFPGLIYRMKQPKIVLLIFVSG Sbjct: 147 LFASYEPELFPGLIYRMKQPKIVLLIFVSG 176 >gb|AAV53354.1| TATA-box binding protein [Volvox carteri f. nagariensis] Length = 340 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -1 Query: 91 MLVQYEPELFPGLIYRMKQPKIVLLIFVSG 2 + YEPELFPGLIYRMKQPKIVLLIFVSG Sbjct: 151 LFASYEPELFPGLIYRMKQPKIVLLIFVSG 180 >ref|XP_004144066.1| PREDICTED: TATA-box-binding protein-like [Cucumis sativus] gi|449493574|ref|XP_004159356.1| PREDICTED: TATA-box-binding protein-like [Cucumis sativus] Length = 200 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 79 YEPELFPGLIYRMKQPKIVLLIFVSG 2 YEPELFPGLIYRMKQPKIVLLIFVSG Sbjct: 143 YEPELFPGLIYRMKQPKIVLLIFVSG 168