BLASTX nr result
ID: Cimicifuga21_contig00020675
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00020675 (480 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520329.1| cyclin A, putative [Ricinus communis] gi|223... 80 2e-13 emb|CBI18982.3| unnamed protein product [Vitis vinifera] 78 8e-13 ref|XP_002284567.1| PREDICTED: cyclin-A1-1-like [Vitis vinifera] 78 8e-13 ref|XP_002306649.1| predicted protein [Populus trichocarpa] gi|2... 77 2e-12 dbj|BAE06271.1| cyclin A [Scutellaria baicalensis] 76 2e-12 >ref|XP_002520329.1| cyclin A, putative [Ricinus communis] gi|223540548|gb|EEF42115.1| cyclin A, putative [Ricinus communis] Length = 498 Score = 80.1 bits (196), Expect = 2e-13 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +3 Query: 3 NSHNSSLPAIREKYSQHKYKFVAKKYCPPSIPSEYFYDQ 119 N HNS+LPAIREKYSQHKYKFVAKKYCPPSIP E+F+DQ Sbjct: 458 NGHNSTLPAIREKYSQHKYKFVAKKYCPPSIPQEFFHDQ 496 >emb|CBI18982.3| unnamed protein product [Vitis vinifera] Length = 550 Score = 77.8 bits (190), Expect = 8e-13 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +3 Query: 3 NSHNSSLPAIREKYSQHKYKFVAKKYCPPSIPSEYFYD 116 N+HNSSLPAIREKYSQHKYKFVAKKYCPPSIPSE F++ Sbjct: 510 NNHNSSLPAIREKYSQHKYKFVAKKYCPPSIPSELFHN 547 >ref|XP_002284567.1| PREDICTED: cyclin-A1-1-like [Vitis vinifera] Length = 495 Score = 77.8 bits (190), Expect = 8e-13 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +3 Query: 3 NSHNSSLPAIREKYSQHKYKFVAKKYCPPSIPSEYFYD 116 N+HNSSLPAIREKYSQHKYKFVAKKYCPPSIPSE F++ Sbjct: 455 NNHNSSLPAIREKYSQHKYKFVAKKYCPPSIPSELFHN 492 >ref|XP_002306649.1| predicted protein [Populus trichocarpa] gi|222856098|gb|EEE93645.1| predicted protein [Populus trichocarpa] Length = 493 Score = 76.6 bits (187), Expect = 2e-12 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = +3 Query: 6 SHNSSLPAIREKYSQHKYKFVAKKYCPPSIPSEYFYDQCC 125 SHNS+LPAIREKYSQHKYKFVAKKYCPPSIP E+F + C Sbjct: 454 SHNSTLPAIREKYSQHKYKFVAKKYCPPSIPEEFFQNLSC 493 >dbj|BAE06271.1| cyclin A [Scutellaria baicalensis] Length = 496 Score = 76.3 bits (186), Expect = 2e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +3 Query: 3 NSHNSSLPAIREKYSQHKYKFVAKKYCPPSIPSEYFYD 116 NSHNSSLPAIREKYSQHKYKFVAKKYCP SIP EYF++ Sbjct: 456 NSHNSSLPAIREKYSQHKYKFVAKKYCPLSIPPEYFHN 493