BLASTX nr result
ID: Cimicifuga21_contig00020632
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00020632 (855 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522804.1| RALFL33, putative [Ricinus communis] gi|2235... 95 2e-17 ref|XP_003632037.1| PREDICTED: uncharacterized protein LOC100250... 94 5e-17 emb|CAN69272.1| hypothetical protein VITISV_001680 [Vitis vinifera] 94 5e-17 ref|XP_003601688.1| Rapid alkalinization factor preproprotein [M... 89 2e-15 gb|AAR00325.2| rapid alkalinization factor 1 [Solanum chacoense] 88 2e-15 >ref|XP_002522804.1| RALFL33, putative [Ricinus communis] gi|223538042|gb|EEF39655.1| RALFL33, putative [Ricinus communis] Length = 114 Score = 94.7 bits (234), Expect = 2e-17 Identities = 41/56 (73%), Positives = 51/56 (91%) Frame = +1 Query: 409 NRRVLMMQKRYISYETLKKDVVPCGKPGAPYYNCHAMGQANPYTRGCEVIARCRNN 576 +RRVL+MQK+YISYETLK+D+VPC KPGA YY+CHA G+ANPY+RGCE+I RCR + Sbjct: 60 SRRVLVMQKKYISYETLKRDMVPCDKPGASYYDCHA-GEANPYSRGCEMITRCRGH 114 >ref|XP_003632037.1| PREDICTED: uncharacterized protein LOC100250260 isoform 1 [Vitis vinifera] gi|359477877|ref|XP_003632038.1| PREDICTED: uncharacterized protein LOC100250260 isoform 2 [Vitis vinifera] Length = 131 Score = 93.6 bits (231), Expect = 5e-17 Identities = 39/53 (73%), Positives = 46/53 (86%) Frame = +1 Query: 409 NRRVLMMQKRYISYETLKKDVVPCGKPGAPYYNCHAMGQANPYTRGCEVIARC 567 +RRVL+MQK+YISYETLKKD++PC +PGA YYNC A G+ANPY RGCEVI C Sbjct: 70 SRRVLVMQKKYISYETLKKDMIPCARPGASYYNCRASGEANPYNRGCEVITGC 122 >emb|CAN69272.1| hypothetical protein VITISV_001680 [Vitis vinifera] Length = 70 Score = 93.6 bits (231), Expect = 5e-17 Identities = 39/53 (73%), Positives = 46/53 (86%) Frame = +1 Query: 409 NRRVLMMQKRYISYETLKKDVVPCGKPGAPYYNCHAMGQANPYTRGCEVIARC 567 +RRVL+MQK+YISYETLKKD++PC +PGA YYNC A G+ANPY RGCEVI C Sbjct: 9 SRRVLVMQKKYISYETLKKDMIPCARPGASYYNCRASGEANPYNRGCEVITGC 61 >ref|XP_003601688.1| Rapid alkalinization factor preproprotein [Medicago truncatula] gi|355490736|gb|AES71939.1| Rapid alkalinization factor preproprotein [Medicago truncatula] Length = 135 Score = 88.6 bits (218), Expect = 2e-15 Identities = 39/53 (73%), Positives = 45/53 (84%) Frame = +1 Query: 409 NRRVLMMQKRYISYETLKKDVVPCGKPGAPYYNCHAMGQANPYTRGCEVIARC 567 NRRVL MQK+YISY+TLK+D+VPC +PGA YYNCH QANPY+RGCEVI C Sbjct: 75 NRRVLAMQKKYISYDTLKRDMVPCDRPGASYYNCHRR-QANPYSRGCEVITAC 126 >gb|AAR00325.2| rapid alkalinization factor 1 [Solanum chacoense] Length = 152 Score = 88.2 bits (217), Expect = 2e-15 Identities = 38/53 (71%), Positives = 43/53 (81%) Frame = +1 Query: 409 NRRVLMMQKRYISYETLKKDVVPCGKPGAPYYNCHAMGQANPYTRGCEVIARC 567 NRRVL+MQK+YISY TLK+D+VPC PGA YYNC A G AN Y RGCE+I RC Sbjct: 91 NRRVLLMQKKYISYGTLKRDLVPCNTPGASYYNCKAPGAANNYNRGCEIITRC 143