BLASTX nr result
ID: Cimicifuga21_contig00020220
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00020220 (441 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528749.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002528749.1| conserved hypothetical protein [Ricinus communis] gi|223531843|gb|EEF33661.1| conserved hypothetical protein [Ricinus communis] Length = 380 Score = 57.0 bits (136), Expect = 2e-06 Identities = 38/137 (27%), Positives = 67/137 (48%) Frame = -1 Query: 441 RKVGSNLYPRAGFETSVTIGVGNNEAVSWALENADSNAKNILSKNKLRGSCRRLDVFGFL 262 +K+GS+ R G + + W LE ++ KN+ +N R S R++ FGFL Sbjct: 212 KKLGSHYTTRLGSDLQDISCNRPGDGGHWDLEADEATPKNVFHENSSRYS--RMNFFGFL 269 Query: 261 SKFWSVYGGKMARTFAKRRNDKEARIFFDQNVSSYIDIPQAEQGTFQSIMQSCTWGCDST 82 + W ++G K+ +++ KR D E + ++ +YID+ + QG Q + S C S Sbjct: 270 NNLWKMWGTKVTKSYIKRLKDGEEQ----RHSPTYIDVSYSAQG--QHMGPSLGSRCRSL 323 Query: 81 RGQWKWYKSNLFFLSAA 31 G +++NL L + Sbjct: 324 TGLCSRFRANLMILGGS 340