BLASTX nr result
ID: Cimicifuga21_contig00020092
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00020092 (216 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004145104.1| PREDICTED: pentatricopeptide repeat-containi... 110 1e-22 ref|XP_003634853.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 103 1e-20 ref|XP_003634851.1| PREDICTED: pentatricopeptide repeat-containi... 103 1e-20 emb|CAN77919.1| hypothetical protein VITISV_027645 [Vitis vinifera] 103 1e-20 ref|XP_003546143.1| PREDICTED: pentatricopeptide repeat-containi... 99 3e-19 >ref|XP_004145104.1| PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Cucumis sativus] gi|449471723|ref|XP_004153390.1| PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Cucumis sativus] gi|449530564|ref|XP_004172264.1| PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Cucumis sativus] Length = 405 Score = 110 bits (275), Expect = 1e-22 Identities = 54/71 (76%), Positives = 64/71 (90%) Frame = +2 Query: 2 KQKTRTALSLLKSEKNPERILDICRAASLTPEFHLDRVAFSVAISNLTESQSFEFIRSFL 181 KQK+R ALSLLK+E+NPERI+DICRAASLTPEFHLDR+AFSVAIS L++ + F+ IR FL Sbjct: 42 KQKSRAALSLLKTEENPERIIDICRAASLTPEFHLDRIAFSVAISKLSKFKHFDGIRRFL 101 Query: 182 EELKLRPDLRN 214 EELK RPDL+N Sbjct: 102 EELKSRPDLKN 112 >ref|XP_003634853.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Vitis vinifera] Length = 336 Score = 103 bits (257), Expect = 1e-20 Identities = 51/70 (72%), Positives = 62/70 (88%) Frame = +2 Query: 2 KQKTRTALSLLKSEKNPERILDICRAASLTPEFHLDRVAFSVAISNLTESQSFEFIRSFL 181 K+K+R ALSLLKSE++P+RIL+ICRAA+LTPE HLDRVAFSVAIS L +S+ F+ IR FL Sbjct: 33 KEKSRAALSLLKSEQDPQRILEICRAAALTPESHLDRVAFSVAISKLADSKHFDSIRHFL 92 Query: 182 EELKLRPDLR 211 +ELK RPDLR Sbjct: 93 DELKARPDLR 102 >ref|XP_003634851.1| PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Vitis vinifera] Length = 396 Score = 103 bits (257), Expect = 1e-20 Identities = 51/70 (72%), Positives = 62/70 (88%) Frame = +2 Query: 2 KQKTRTALSLLKSEKNPERILDICRAASLTPEFHLDRVAFSVAISNLTESQSFEFIRSFL 181 K+K+R ALSLLKSE++P+RIL+ICRAA+LTPE HLDRVAFSVAIS L +S+ F+ IR FL Sbjct: 33 KEKSRAALSLLKSEQDPQRILEICRAAALTPESHLDRVAFSVAISKLADSKHFDSIRHFL 92 Query: 182 EELKLRPDLR 211 +ELK RPDLR Sbjct: 93 DELKARPDLR 102 >emb|CAN77919.1| hypothetical protein VITISV_027645 [Vitis vinifera] Length = 396 Score = 103 bits (257), Expect = 1e-20 Identities = 51/70 (72%), Positives = 62/70 (88%) Frame = +2 Query: 2 KQKTRTALSLLKSEKNPERILDICRAASLTPEFHLDRVAFSVAISNLTESQSFEFIRSFL 181 K+K+R ALSLLKSE++P+RIL+ICRAA+LTPE HLDRVAFSVAIS L +S+ F+ IR FL Sbjct: 33 KEKSRAALSLLKSEQDPQRILEICRAAALTPESHLDRVAFSVAISKLADSKHFDSIRHFL 92 Query: 182 EELKLRPDLR 211 +ELK RPDLR Sbjct: 93 DELKARPDLR 102 >ref|XP_003546143.1| PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Glycine max] Length = 388 Score = 99.4 bits (246), Expect = 3e-19 Identities = 48/71 (67%), Positives = 59/71 (83%) Frame = +2 Query: 2 KQKTRTALSLLKSEKNPERILDICRAASLTPEFHLDRVAFSVAISNLTESQSFEFIRSFL 181 KQKTR+A+ LLKSE NPERILDICRAA+LTP+ H+DR AFS+A+S L + F IR+FL Sbjct: 27 KQKTRSAIHLLKSETNPERILDICRAAALTPDSHIDRRAFSLAVSKLAAAHHFAGIRTFL 86 Query: 182 EELKLRPDLRN 214 ++LK RPDLRN Sbjct: 87 DDLKTRPDLRN 97