BLASTX nr result
ID: Cimicifuga21_contig00019950
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00019950 (367 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC16741.1| Contains similarity to gb|Z69902 from C. elegans ... 62 6e-08 ref|XP_002283373.2| PREDICTED: dymeclin-like [Vitis vinifera] gi... 60 2e-07 ref|XP_002315750.1| predicted protein [Populus trichocarpa] gi|2... 59 4e-07 ref|XP_004134115.1| PREDICTED: dymeclin-like [Cucumis sativus] g... 58 7e-07 ref|NP_171916.2| uncharacterized protein [Arabidopsis thaliana] ... 57 2e-06 >gb|AAC16741.1| Contains similarity to gb|Z69902 from C. elegans [Arabidopsis thaliana] Length = 814 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -1 Query: 256 CRHLASEGSVLLLYSVVHGNSDFLEYVLVRTDLDTLV 146 CR LA EG+VLLLYS++ GNSDF EYVLVRTDLDTL+ Sbjct: 438 CRFLADEGAVLLLYSLLQGNSDFKEYVLVRTDLDTLL 474 >ref|XP_002283373.2| PREDICTED: dymeclin-like [Vitis vinifera] gi|297737110|emb|CBI26311.3| unnamed protein product [Vitis vinifera] Length = 726 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 247 LASEGSVLLLYSVVHGNSDFLEYVLVRTDLDTLV 146 LA E ++LLLYS+VHGNSDFLEYVLVRTDLDTL+ Sbjct: 370 LADETAILLLYSLVHGNSDFLEYVLVRTDLDTLL 403 >ref|XP_002315750.1| predicted protein [Populus trichocarpa] gi|222864790|gb|EEF01921.1| predicted protein [Populus trichocarpa] Length = 722 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 247 LASEGSVLLLYSVVHGNSDFLEYVLVRTDLDTLV 146 LA E +VLLLY++VHGNSDFLEYVLVRTDLDTL+ Sbjct: 366 LADETAVLLLYTLVHGNSDFLEYVLVRTDLDTLL 399 >ref|XP_004134115.1| PREDICTED: dymeclin-like [Cucumis sativus] gi|449504142|ref|XP_004162264.1| PREDICTED: dymeclin-like [Cucumis sativus] Length = 726 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 247 LASEGSVLLLYSVVHGNSDFLEYVLVRTDLDTLV 146 LA EGSVLLLYS++ GN DFLEYVLVRTDLDTL+ Sbjct: 367 LADEGSVLLLYSLLQGNPDFLEYVLVRTDLDTLL 400 >ref|NP_171916.2| uncharacterized protein [Arabidopsis thaliana] gi|20268678|gb|AAM14043.1| unknown protein [Arabidopsis thaliana] gi|21689843|gb|AAM67565.1| unknown protein [Arabidopsis thaliana] gi|332189548|gb|AEE27669.1| uncharacterized protein [Arabidopsis thaliana] Length = 732 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -1 Query: 247 LASEGSVLLLYSVVHGNSDFLEYVLVRTDLDTLV 146 LA EG+VLLLYS++ GNSDF EYVLVRTDLDTL+ Sbjct: 369 LADEGAVLLLYSLLQGNSDFKEYVLVRTDLDTLL 402