BLASTX nr result
ID: Cimicifuga21_contig00019846
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00019846 (684 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267303.1| PREDICTED: pentatricopeptide repeat-containi... 66 6e-09 ref|XP_002522543.1| pentatricopeptide repeat-containing protein,... 64 4e-08 gb|AFW64656.1| pentatricopeptide repeat protein PPR868-14 isofor... 63 6e-08 ref|XP_002450172.1| hypothetical protein SORBIDRAFT_05g001460 [S... 61 2e-07 ref|XP_002305756.1| predicted protein [Populus trichocarpa] gi|2... 61 2e-07 >ref|XP_002267303.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Vitis vinifera] Length = 533 Score = 66.2 bits (160), Expect = 6e-09 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -2 Query: 683 LSNTLAATGNWDGVSGVREMMKERRVSKDTGCSWVGTESG 564 LSN LAA G WD VS VR++MK R VSKDTGCSWVGT+SG Sbjct: 493 LSNALAAAGKWDSVSEVRQLMKVRGVSKDTGCSWVGTDSG 532 >ref|XP_002522543.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223538234|gb|EEF39843.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 530 Score = 63.5 bits (153), Expect = 4e-08 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -2 Query: 683 LSNTLAATGNWDGVSGVREMMKERRVSKDTGCSWVGTESGL 561 LSNTLAA G WDGV+ VRE+MK R + KDTG SWVGTES L Sbjct: 490 LSNTLAAAGKWDGVTEVREIMKSRGILKDTGSSWVGTESVL 530 >gb|AFW64656.1| pentatricopeptide repeat protein PPR868-14 isoform 1 [Zea mays] gi|413924725|gb|AFW64657.1| pentatricopeptide repeat protein PPR868-14 isoform 2 [Zea mays] gi|413924726|gb|AFW64658.1| pentatricopeptide repeat protein PPR868-14 isoform 3 [Zea mays] Length = 522 Score = 62.8 bits (151), Expect = 6e-08 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -2 Query: 680 SNTLAATGNWDGVSGVREMMKERRVSKDTGCSWVGTES 567 SNTLAA G WDGV VREMMK+R V KDT CSWVG+E+ Sbjct: 480 SNTLAAAGEWDGVHDVREMMKQRGVLKDTACSWVGSEN 517 >ref|XP_002450172.1| hypothetical protein SORBIDRAFT_05g001460 [Sorghum bicolor] gi|241936015|gb|EES09160.1| hypothetical protein SORBIDRAFT_05g001460 [Sorghum bicolor] Length = 521 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 680 SNTLAATGNWDGVSGVREMMKERRVSKDTGCSWVGTES 567 SNTLAA G W+GV VREMMK+R V KDT CSWVG+E+ Sbjct: 479 SNTLAAAGKWEGVHDVREMMKQRGVLKDTACSWVGSEN 516 >ref|XP_002305756.1| predicted protein [Populus trichocarpa] gi|222848720|gb|EEE86267.1| predicted protein [Populus trichocarpa] Length = 530 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = -2 Query: 683 LSNTLAATGNWDGVSGVREMMKERRVSKDTGCSWVGTESGL 561 LSNTLAA WD VS +REMMK R +SKDT CSWVGTE L Sbjct: 490 LSNTLAAAERWDSVSELREMMKLRGISKDTACSWVGTEVDL 530