BLASTX nr result
ID: Cimicifuga21_contig00019814
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00019814 (221 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF36656.2| putative carotenoid cleavage dioxygenase [Chrysa... 59 4e-07 gb|ABY60887.1| carotenoid cleavage dioxygenase 4 [Osmanthus frag... 58 7e-07 gb|ABK24456.1| unknown [Picea sitchensis] 57 2e-06 ref|XP_003612461.1| 50S ribosomal protein L14 [Medicago truncatu... 57 2e-06 dbj|BAM63316.1| carotenoid cleavage dioxygenase [Chrysanthemum x... 56 3e-06 >dbj|BAF36656.2| putative carotenoid cleavage dioxygenase [Chrysanthemum x morifolium] Length = 594 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 3 SPTLDIVASVKLPGRVPYGFHGLFVSDSDITKL 101 SPTL+IVA+VKLP RVPYGFHGLFV +SDI KL Sbjct: 562 SPTLEIVAAVKLPRRVPYGFHGLFVKESDINKL 594 >gb|ABY60887.1| carotenoid cleavage dioxygenase 4 [Osmanthus fragrans] Length = 609 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 3 SPTLDIVASVKLPGRVPYGFHGLFVSDSDITKL 101 SP LDIVA+VKLP RVPYGFHGLFVS++D+ KL Sbjct: 577 SPNLDIVAAVKLPRRVPYGFHGLFVSENDLNKL 609 >gb|ABK24456.1| unknown [Picea sitchensis] Length = 612 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 3 SPTLDIVASVKLPGRVPYGFHGLFVSDSDI 92 SPTL+IVASV+LP RVPYGFHGLFVSD+D+ Sbjct: 579 SPTLEIVASVELPARVPYGFHGLFVSDADL 608 >ref|XP_003612461.1| 50S ribosomal protein L14 [Medicago truncatula] gi|355513796|gb|AES95419.1| 50S ribosomal protein L14 [Medicago truncatula] Length = 696 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 3 SPTLDIVASVKLPGRVPYGFHGLFVSDSDITKL 101 SP +IVA VKLP RVPYGFHGLFV +SDITKL Sbjct: 546 SPEFEIVAEVKLPRRVPYGFHGLFVKESDITKL 578 >dbj|BAM63316.1| carotenoid cleavage dioxygenase [Chrysanthemum x morifolium] Length = 599 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +3 Query: 3 SPTLDIVASVKLPGRVPYGFHGLFVSDSDITKL 101 SPTL+IVA+VKLP RVPYGFHGLFV ++D+T L Sbjct: 567 SPTLEIVAAVKLPHRVPYGFHGLFVRENDLTTL 599