BLASTX nr result
ID: Cimicifuga21_contig00019783
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00019783 (209 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003851048.1| hypothetical protein MYCGRDRAFT_74254, parti... 73 3e-11 gb|EME80502.1| hypothetical protein MYCFIDRAFT_141089, partial [... 70 2e-10 ref|XP_001383614.1| hypothetical protein PICST_57317 [Schefferso... 70 2e-10 gb|EMF07912.1| hypothetical protein SEPMUDRAFT_55174, partial [M... 68 7e-10 gb|EME38015.1| hypothetical protein DOTSEDRAFT_181978, partial [... 68 7e-10 >ref|XP_003851048.1| hypothetical protein MYCGRDRAFT_74254, partial [Zymoseptoria tritici IPO323] gi|398395191|ref|XP_003851054.1| hypothetical protein MYCGRDRAFT_74248, partial [Zymoseptoria tritici IPO323] gi|339470927|gb|EGP86024.1| hypothetical protein MYCGRDRAFT_74254 [Zymoseptoria tritici IPO323] gi|339470933|gb|EGP86030.1| hypothetical protein MYCGRDRAFT_74248 [Zymoseptoria tritici IPO323] Length = 88 Score = 72.8 bits (177), Expect = 3e-11 Identities = 35/41 (85%), Positives = 35/41 (85%) Frame = +2 Query: 2 AYQKWPTSNDTFKCPRSTK*QGLLTYLKFENRLRLFQPQGL 124 AYQKWPTSNDTFKCPR LLTYLKFENRLRLFQPQGL Sbjct: 54 AYQKWPTSNDTFKCPR------LLTYLKFENRLRLFQPQGL 88 >gb|EME80502.1| hypothetical protein MYCFIDRAFT_141089, partial [Pseudocercospora fijiensis CIRAD86] Length = 88 Score = 70.1 bits (170), Expect = 2e-10 Identities = 34/41 (82%), Positives = 34/41 (82%) Frame = +2 Query: 2 AYQKWPTSNDTFKCPRSTK*QGLLTYLKFENRLRLFQPQGL 124 AYQKWPTSN TFKCPR LLTYLKFENRLRLFQPQGL Sbjct: 54 AYQKWPTSNGTFKCPR------LLTYLKFENRLRLFQPQGL 88 >ref|XP_001383614.1| hypothetical protein PICST_57317 [Scheffersomyces stipitis CBS 6054] gi|126095763|gb|ABN65585.1| predicted protein, partial [Scheffersomyces stipitis CBS 6054] Length = 94 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = +2 Query: 2 AYQKWPTSNDTFKCPRSTK*QGLLTYLKFENRLRLFQPQGL 124 AYQKWPT + +F CPRS K QGLLTYLKFENRLR FQPQ L Sbjct: 54 AYQKWPTKSSSFICPRSIKQQGLLTYLKFENRLRSFQPQDL 94 >gb|EMF07912.1| hypothetical protein SEPMUDRAFT_55174, partial [Mycosphaerella populorum SO2202] Length = 86 Score = 68.2 bits (165), Expect = 7e-10 Identities = 33/41 (80%), Positives = 33/41 (80%) Frame = +2 Query: 2 AYQKWPTSNDTFKCPRSTK*QGLLTYLKFENRLRLFQPQGL 124 AYQKWPTSN FKCPR LLTYLKFENRLRLFQPQGL Sbjct: 52 AYQKWPTSNGAFKCPR------LLTYLKFENRLRLFQPQGL 86 >gb|EME38015.1| hypothetical protein DOTSEDRAFT_181978, partial [Dothistroma septosporum NZE10] Length = 88 Score = 68.2 bits (165), Expect = 7e-10 Identities = 33/41 (80%), Positives = 33/41 (80%) Frame = +2 Query: 2 AYQKWPTSNDTFKCPRSTK*QGLLTYLKFENRLRLFQPQGL 124 AYQKWPTSN FKCPR LLTYLKFENRLRLFQPQGL Sbjct: 54 AYQKWPTSNGAFKCPR------LLTYLKFENRLRLFQPQGL 88