BLASTX nr result
ID: Cimicifuga21_contig00019655
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00019655 (338 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002880609.1| hypothetical protein ARALYDRAFT_901029 [Arab... 57 3e-08 tpg|DAA37683.1| TPA: hypothetical protein ZEAMMB73_237524 [Zea m... 61 1e-07 ref|XP_002447884.1| hypothetical protein SORBIDRAFT_06g017410 [S... 61 1e-07 gb|ACG44886.1| F-box domain containing protein [Zea mays] 61 1e-07 ref|NP_001132289.1| uncharacterized protein LOC100193729 [Zea ma... 61 1e-07 >ref|XP_002880609.1| hypothetical protein ARALYDRAFT_901029 [Arabidopsis lyrata subsp. lyrata] gi|297326448|gb|EFH56868.1| hypothetical protein ARALYDRAFT_901029 [Arabidopsis lyrata subsp. lyrata] Length = 464 Score = 57.4 bits (137), Expect(2) = 3e-08 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = -2 Query: 331 LLHHILSFLPTQNVVQTCVLSKRWRDIWCSIPSLDLDQRLL 209 +L HILSF+PT+ ++ +LSKRWR +WC IPSL LD + L Sbjct: 36 ILQHILSFIPTKLAIRASLLSKRWRHVWCDIPSLSLDDQTL 76 Score = 25.4 bits (54), Expect(2) = 3e-08 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -1 Query: 92 VNAWILYALKHNVEVMDIDILN 27 +N W+ +A+ NVE + +D N Sbjct: 107 INKWVEFAISRNVENLSLDFWN 128 >tpg|DAA37683.1| TPA: hypothetical protein ZEAMMB73_237524 [Zea mays] Length = 360 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -2 Query: 331 LLHHILSFLPTQNVVQTCVLSKRWRDIWCSIPSLDLDQ 218 L+HHI+SFL + VVQTCVLS RWR +W S+P LD+DQ Sbjct: 31 LIHHIMSFLKARQVVQTCVLSTRWRHLWRSVPCLDIDQ 68 >ref|XP_002447884.1| hypothetical protein SORBIDRAFT_06g017410 [Sorghum bicolor] gi|241939067|gb|EES12212.1| hypothetical protein SORBIDRAFT_06g017410 [Sorghum bicolor] Length = 426 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -2 Query: 331 LLHHILSFLPTQNVVQTCVLSKRWRDIWCSIPSLDLDQ 218 L+HHI+SFL + VVQTCVLS RWR +W S+P LD+DQ Sbjct: 33 LIHHIMSFLKARQVVQTCVLSTRWRHLWRSVPCLDIDQ 70 >gb|ACG44886.1| F-box domain containing protein [Zea mays] Length = 420 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -2 Query: 331 LLHHILSFLPTQNVVQTCVLSKRWRDIWCSIPSLDLDQ 218 L+HHI+SFL + VVQTCVLS RWR +W S+P LD+DQ Sbjct: 31 LIHHIMSFLKARQVVQTCVLSTRWRHLWRSVPCLDIDQ 68 >ref|NP_001132289.1| uncharacterized protein LOC100193729 [Zea mays] gi|194693982|gb|ACF81075.1| unknown [Zea mays] gi|414587113|tpg|DAA37684.1| TPA: F-box domain containing protein isoform 1 [Zea mays] gi|414587114|tpg|DAA37685.1| TPA: F-box domain containing protein isoform 2 [Zea mays] Length = 423 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -2 Query: 331 LLHHILSFLPTQNVVQTCVLSKRWRDIWCSIPSLDLDQ 218 L+HHI+SFL + VVQTCVLS RWR +W S+P LD+DQ Sbjct: 31 LIHHIMSFLKARQVVQTCVLSTRWRHLWRSVPCLDIDQ 68